ESTScan Details for Unigene SGN-U300128

Score 
751
Direction 
Forward
Predicted Peptide Sequence 
MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTSGSPTMANASALIVATTAPSGVAMSPGIRLXLLTGSADQTAKLWNVKTGTQLYTF
NFDSPTRSVDFGVGDKLAVITTDPFMGLPSAIQVKRIARDPADQSGESILVLKGPQGRINRAVWGPLNKTIISGGEDSVIRIWDSETGKL
LKESDKEAGHKKGITSLSKSNDATHFISGSLDKSAKLWDMRTLTLLKTYTTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEA
KFYDKVLQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDPDYFNIKSRLXIVKLRDLLSPTALVXLMANNFACGSYLKALV
YGSPVFVINLILQLEETVPKKKKXEAIENCFAV
Predicted Coding Sequence 
ATGAGGCCGATACTGATGAAAGGCCATGAGAGGCCGCTGACATTTTTGAAGTACAACAGAGACGGCGACCTTCTATTCTCGTGCGCCAAG
GATCATACTCCAACCTCTGGTTCGCCGACAATGGCGAACGCCTCGGCACTTATCGTGGCCACAACGGCGCCGTCTGGTGTTGCGATGTCT
CCAGGGATTCGTCTTXTGCTGTTAACTGGAAGTGCGGATCAGACAGCAAAACTTTGGAATGTTAAAACAGGGACTCAGCTGTACACTTTC
AACTTCGACTCACCAACTAGGTCTGTTGATTTTGGAGTTGGTGATAAACTTGCTGTCATAACAACTGACCCCTTTATGGGATTGCCTTCT
GCAATTCAAGTGAAACGAATTGCCAGAGATCCTGCTGACCAGTCCGGTGAATCTATTCTTGTACTCAAAGGACCTCAGGGAAGAATTAAC
AGGGCTGTTTGGGGACCTTTGAACAAGACTATCATAAGTGGTGGTGAAGATTCTGTAATACGTATCTGGGATTCTGAGACTGGGAAATTA
CTCAAAGAGTCTGACAAGGAGGCTGGTCACAAAAAAGGCATAACATCACTTTCAAAATCCAATGATGCGACGCATTTCATCAGTGGTTCT
CTTGATAAGTCAGCTAAACTGTGGGATATGAGAACATTGACACTTCTGAAGACCTATACAACTGAACGTCCTGTGAATGCAGTTGCAATG
TCTCCGCTTCTTGATCATGTGGTTCTTGGAGGTGGTCAGGATGCATCAGCTGTTACTACCACTGACCATCGTGCTGGAAAGTTTGAGGCA
AAATTCTATGACAAGGTTCTTCAAGAAGAGATTGGAGGGGTTAAAGGTCACTTTGGGCCAATCAACGCCTTGGCATTCAATCCTGACGGA
AAAAGTTTCGCAAGTGGAGGTGAAGATGGGTATGTGAGACTGCATCACTTTGATCCGGACTACTTCAACATCAAGTCTAGACTAGAXATC
GTCAAATTAAGGGATCTCCTTTCTCCAACAGCTCTTGTAGXTCTAATGGCCAACAATTTTGCTTGTGGATCTTACTTAAAAGCTCTAGTC
TATGGAAGCCCTGTATTCGTGATTAATCTTATTTTACAACTTGAGGAAACTGTGCCTAAAAAGAAAAAGGXAGAAGCTATAGAGAACTGT
TTTGCGGTX
Edits in Original Sequence 
TCCAAGTCTCTTTCTGTTACCAGAACCAACTAGGGTTTTTGTTTCCTTTGTTCTTCTTCTTCTTCTTCTTTTTTCCTTTGTTAAACCACA
GTTTTGTCGTTCACCAAATCACAATCATAATCTAGTAAGTTTTGCCGTATACTG
(5')ATGAGGCCGATACTGATGAAAGGCCATGAGAG
GCCGCTGACATTTTTGAAGTACAACAGAGACGGCGACCTTCTATTCTCGTGCGCCAAGGATCATACTCCAACCgTCTGGTTCGCCGACAA
TGGCGAACGCCTCGGCACTTATCGTGGCCACAACGGCGCCGTCTGGTGTTGCGATGTCTCCAGGGATTCGTCTTXTGCTGTTAACTGGAA
GTGCGGATCAGACAGCAAAACTTTGGAATGTTAAAACAGGGACTCAGCTGTACACTTTCAACTTCGACTCACCAACTAGGTCTGTTGATT
TTGGAGTTGGTGATAAACTTGCTGTCATAACAACTGACCCCTTTATGGGATTGCCTTCTGCAATTCAAGTGAAACGAATTGCCAGAGATC
CTGCTGACCAGTCCGGTGAATCTATTCTTGTACTCAAAGGACCTCAGGGAAGAATTAACAGGGCTGTTTGGGGACCTTTGAACAAGACTA
TCATAAGTGGTGGTGAAGATTCTGTAATACGTATCTGGGATTCTGAGACTGGGAAATTACTCAAAGAGTCTGACAAGGAGGCTGGTCACA
AAAAAGGCATAACATCACTTTCAAAATCCAATGATGCGACGCATTTCATCAGTGGTTCTCTTGATAAGTCAGCTAAACTGTGGGATATGA
GAACATTGACACTTCTGAAGACCTATACAACTGAACGTCCTGTGAATGCAGTTGCAATGTCTCCGCTTCTTGATCATGTGGTTCTTGGAG
GTGGTCAGGATGCATCAGCTGTTACTACCACTGACCATCGTGCTGGAAAGTTTGAGGCAAAATTCTATGACAAGGTTCTTCAAGAAGAGA
TTGGAGGGGTTAAAGGTCACTTTGGGCCAATCAACGCCTTGGCATTCAATCCTGACGGAAAAAGTTTCGCAAGTGGAGGTGAAGATGGGT
ATGTGAGACTGCATCACTTTGATCCGGACTACTTCAACATCAAGaTCTAGACTAGAXATCGTCAAATTAAGGGATCTCCTTTCTCCAACA
GCTCTTGTAGXTCTAATGGCCAACAATTTTGCTTGTGGATCTTACTTAAAAcGCTCTAGTCTATGGAAGCCCTGTATTCGTGATTAATCT
TATTTTACAACTTGAGGAAACTGTGCCTAAAAAGAAAAAGGXAGAAGCTATAGAGAACTGTTTTGCGGTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan