Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U300151

Score 
1299
Direction 
Forward
Predicted Peptide Sequence 
DSETKQMKQARKKVDESSNAGDGYSLKRNGESKKRVRGKAASENEGTKTSAKDDLKQTHKSPTRSAKDEGSSEETVRMSTKRKRTASKDK
GTADVEYGSNLVGLKVKVWWPHDRQFYEGVIHSFDSAKKKHKVAYNDGDEEILNLKKERWELVDDGSVSSEEQGAETAIPDTASGMQRRK
KGRRNPESSIKPGKKEVSPKSGAASSGKAKGTATKSGHKTEDDQKLKDRTTKSVAKSEDDSTGKAKSQRTGDKHPDDFTKTSVKSKDVDT
STPKAKSKQDIPKTGSMSKQDTPKTGIKSKSKTPQAGGDGSANGTGKIKHSSSKMKETEDLKERSKDKSTDVLKTPEGVKVKSSEASKVQ
EXKSKREEATESRLGYVSCCYICSVPSDALHRRSGAGCLRVMSIILLSDVILNHWLHLLPLGSLDKRRS
Predicted Coding Sequence 
XGCGATTCAGAGACAAAACAGATGAAGCAAGCAAGAAAGAAAGTTGATGAAAGTAGTAATGCTGGGGATGGATATTCATTAAAGAGGAAT
GGAGAAAGCAAAAAGCGTGTGCGTGGAAAAGCTGCCTCAGAGAATGAAGGGACTAAGACCTCTGCTAAAGATGATCTGAAGCAGACACAC
AAGTCTCCTACAAGATCAGCAAAAGATGAAGGTTCTTCTGAAGAAACAGTTAGGATGAGTACCAAGAGGAAGCGTACAGCAAGCAAAGAC
AAAGGAACTGCAGATGTCGAGTATGGTAGTAACTTGGTGGGTTTAAAGGTTAAGGTTTGGTGGCCTCACGATCGTCAGTTTTATGAAGGT
GTTATTCATTCTTTTGATTCTGCAAAGAAAAAGCATAAGGTTGCCTACAATGATGGTGATGAGGAAATTTTGAACCTTAAGAAAGAACGA
TGGGAATTGGTTGATGATGGTTCAGTTTCTTCTGAAGAGCAAGGAGCTGAAACAGCAATCCCTGATACTGCATCTGGAATGCAAAGGAGG
AAGAAAGGTAGAAGAAATCCTGAATCATCCATTAAGCCGGGGAAGAAAGAGGTCTCACCTAAAAGTGGAGCTGCTTCATCTGGCAAGGCA
AAAGGAACTGCAACAAAATCTGGTCATAAAACTGAGGATGACCAGAAGTTGAAAGATAGGACCACAAAGTCTGTAGCTAAGAGTGAGGAT
GACAGCACTGGTAAAGCTAAATCTCAAAGAACTGGTGATAAACATCCTGATGATTTCACAAAAACATCTGTCAAATCTAAAGATGTTGAT
ACTAGCACACCCAAAGCCAAATCCAAGCAAGACATTCCAAAGACTGGTAGCATGTCGAAGCAAGACACTCCGAAGACTGGTATAAAGTCC
AAAAGTAAGACCCCCCAAGCTGGTGGTGATGGTAGTGCAAATGGAACGGGAAAGATAAAACATAGCTCTTCAAAGATGAAAGAGACCGAG
GATTTGAAAGAAAGATCCAAAGATAAGTCTACTGATGTGCTAAAAACACCTGAAGGGGTAAAAGTCAAATCGTCAGAAGCGTCTAAGGTC
CAAGAAAAXAAATCAAAGCGTGAAGAAGCGACGGAGAGCAGGCTAGGATATGTTTCATGTTGCTACATCTGCTCAGTTCCTTCTGATGCA
TTGCATCGTCGTTCTGGAGCTGGATGTCTGAGAGTCATGTCTATTATACTCTTGTCAGATGTAATCCTGAATCATTGGCTTCATTTGCTT
CCATTAGGCAGTTTAGATAAAAGGAGGTCGTAG
Edits in Original Sequence 
(5')XGCGATTCAGAGACAAAACAGATGAAGCAAGCAAGAAAGAAAGTTGATGAAAGTAGTAATGCTGGGGATGGATATTCATTAAAGAG
GAATGGAGAAAGCAAAAAGCGTGTGCGTGGAAAAGCTGCCTCAGAGAATGAAGGGACTAAGACCTCTGCTAAAGATGATCTGAAGCAGAC
ACACAAGTCTCCTACAAGATCAGCAAAAGATGAAGGTTCTTCTGAAGAAACAGTTAGGATGAGTACCAAGAGGAAGCGTACAGCAAGCAA
AGACAAAGGAACTGCAGATGTCGAGTATGGTAGTAACTTGGTGGGTTTAAAGGTTAAGGTTTGGTGGCCTCACGATCGTCAGTTTTATGA
AGGTGTTATTCATTCTTTTGATTCTGCAAAGAAAAAGCATAAGGTTGCCTACAATGATGGTGATGAGGAAATTTTGAACCTTAAGAAAGA
ACGATGGGAATTGGTTGATGATGGTTCAGTTTCTTCTGAAGAGCAAGGAGCTGAAACAGCAATCCCTGATACTGCATCTGGAATGCAAAG
GAGGAAGAAAGGTAGAAGAAATCCTGAATCATCCATTAAGCCGGGGAAGAAAGAGGTCTCACCTAAAAGTGGAGCTGCTTCATCTGGCAA
GGCAAAAGGAACTGCAACAAAATCTGGTCATAAAACTGAGGATGACCAGAAGTTGAAAGATAGGACCACAAAGTCTGTAGCTAAGAGTGA
GGATGACAGCACTGGTAAAGCTAAATCTCAAAGAACTGGTGATAAACATCCTGATGATTTCACAAAAACATCTGTCAAATCTAAAGATGT
TGATACTAGCACACCCAAAGCCAAATCCAAGCAAGACATTCCAAAGACTGGTAGCATGTCGAAGCAAGACACTCCGAAGACTGGTATAAA
GTCCAAAAGTAAGACCCCCCAAGCTGGTGGTGATGGTAGTGCAAATGGAACGGGAAAGATAAAACATAGCTCTTCAAAGATGAAAGAGAC
CGAGGATTTGAAAGAAAGATCCAAAGATAAGTCTACTGATGTGCTAAAAACACCTGAAGGGGTAAAAGTCAAATCGTCAGAAGCGTCTAA
GGTCCAAGAAAAXAAATCAAAGCGTGAAGAAGCGACGGAGAGCAGGCTAGGATATGTTTCATGTTGCTACATCTGCTCAGTTCCTTCTGA
TGCATTGCATCGTCGTTCTGGAGCTGGATGTCTGAGAGTCATGTCTATTATACTCTTGTCAGATGTAATCCTGAATCATTGGCTTCATTT
GCTTCCATTAGGCAGTTTAGATAAAAGGAGGTCGTAG(3')GAGTTAAATTTATTTTGTTGTTCAGTCAGGACTTCTTTTGGTTAGTGTC
GTGTTATTGTTTGTTAGATATAATCTACTTGAAGGCTTAAGTTGCGATGCTTGGATCATGCTATAAGAAGCTTTCAGTATTGTTCGCAGA
TTAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan