ESTScan Details for Unigene SGN-U300263

Score 
1521
Direction 
Forward
Predicted Peptide Sequence 
MADEAKAKGNAAFSAGKYEEAIRHFTEAINFSPTNHVLYSNRSAAYASLGKYSDALPDAEKTVELKPDWSKGYSRLGAAHLGLRRYDDAV
SAYNKGLEIDPNNDALKSGLADAQSAQARSRPAQQPPSPFGDVFSGTEMWAKLTADPSTRALLQQPDFXEDHAGYSEKSQQFEYVSQGPE
GNAGSRGVVGLEVEWRGGPEEDTEMPESSPERKRPAEAEPVKEEKRPEKAPEPEPEPMELSGEVKEVKVRKAQAHKEKEAGNAAYKKKDF
EAAIQHYTKAFELDDEDISFLTNRAALYLEMGKYEDCIKDCDKAVERGRELRSDFKMIARALTRKGTALVKMAKCSKDYEPAIETFQKAL
TEHRNPDTLKKLNEAEKAKKELEQQEYFDPQIADEEREKGNQYFKEQKFPEAVKHYTESIKRNPKDPRAYSNRAACYTKLTALPEGLKDA
EKCIELDPTFVKGYTRKGAAQFLMKEYEKALETYQEGLKLDRHNQELLDGVRRCVEQINKASRGDLTPEELKERQAKGMQDPEIQNILTD
Predicted Coding Sequence 
ATGGCTGACGAAGCCAAGGCCAAGGGCAACGCCGCCTTCTCTGCCGGAAAGTATGAGGAGGCCATCCGCCACTTCACGGAGGCTATTAAT
TTCTCCCCAACTAACCACGTCCTCTACTCCAATCGATCCGCCGCCTATGCTTCTCTTGGTAAGTATTCCGACGCCCTCCCCGACGCCGAG
AAAACCGTCGAGCTTAAACCCGACTGGTCCAAGGGCTATTCCCGTCTCGGGGCGGCTCATTTAGGTTTGCGTCGCTACGACGACGCCGTT
TCGGCGTACAACAAGGGTCTTGAGATTGACCCCAATAATGATGCTCTTAAATCTGGGCTTGCTGATGCTCAATCTGCTCAGGCCCGATCC
AGGCCCGCGCAGCAACCTCCAAGCCCGTTTGGGGATGTTTTCTCCGGGACGGAGATGTGGGCGAAGCTTACGGCGGATCCCTCAACGCGG
GCTTTGCTCCAGCAGCCTGATTTTGXTGAGGACCATGCAGGATATTCAGAAAAATCCCAGCAGTTTGAATACGTATCTCAAGGACCAGAG
GGTAATGCAGGCTCTCGGGGTGTTGTTGGGCTTGAAGTTGAATGGAGAGGTGGGCCAGAAGAAGATACCGAAATGCCCGAGTCGTCGCCG
GAGCGCAAGAGGCCTGCGGAGGCTGAGCCTGTGAAGGAGGAGAAGAGACCTGAGAAGGCGCCCGAGCCGGAACCGGAACCAATGGAGCTT
TCAGGGGAAGTGAAGGAGGTTAAGGTGAGGAAAGCCCAGGCCCATAAGGAGAAGGAAGCTGGGAATGCTGCCTATAAAAAGAAGGATTTC
GAAGCTGCAATCCAACATTACACTAAAGCTTTTGAGCTTGATGATGAGGATATTTCCTTCCTCACCAATAGGGCAGCACTGTACTTGGAA
ATGGGGAAGTATGAGGATTGCATTAAAGACTGTGACAAAGCAGTTGAAAGAGGAAGAGAGCTGAGGTCAGACTTCAAGATGATCGCAAGG
GCTCTGACAAGAAAGGGAACTGCCTTAGTCAAGATGGCAAAATGTTCAAAGGATTATGAACCTGCTATTGAGACTTTCCAGAAGGCACTG
ACAGAGCACCGCAATCCTGACACACTGAAGAAGCTCAATGAAGCTGAGAAGGCAAAGAAAGAACTAGAGCAACAGGAGTATTTTGATCCA
CAGATAGCTGATGAGGAGCGTGAAAAAGGGAATCAGTATTTTAAAGAGCAGAAGTTCCCAGAAGCTGTCAAGCACTACACAGAATCCATC
AAGAGGAACCCAAAAGATCCAAGGGCTTATAGTAACAGGGCTGCTTGCTATACAAAGCTAACGGCTTTACCTGAGGGATTGAAAGATGCT
GAAAAGTGCATTGAGCTTGATCCAACATTTGTCAAGGGGTATACAAGAAAGGGTGCTGCCCAGTTTTTGATGAAAGAATATGAAAAGGCT
TTAGAAACATACCAGGAAGGATTGAAGCTTGATCGNCACAACCAGGAATTGCTAGATGGCGTTAGAAGATGTGTAGAACAAATTAACAAG
GCAAGCCGCGGGGATCTAACCCCTGAGGAGCTXAAAGAAAGACAGGCCAAGGGCATGCAGGATCCTGAAATCCAAAATATCCTCACTGAT
Edits in Original Sequence 
GAAAAAGAAAGAAAAAAAAANAGAAGCACTCTTTAAATCCATACCCAAGATTAGCTTCTTTCTAATTACTTTTATTGATTGATTA(5')A
TGGCTGACGAAGCCAAGGCCAAGGGCAACGCCGCCTTCTCTGCCGGAAAGTATGAGGAGGCCATCCGCCACTTCACGGAGGCTATTAATT
TCTCCCCAACTAACCACGTCCTCTACTCCAATCGATCCGCCGCCTATGCTTCTCTTGGTAAGTATTCCGACGCCCTCCCCGACGCCGAGA
AAACCGTCGAGCTTAAACCCGACTGGTCCAAGGGCTATTCCCGTCTCGGGGCGGCTCATTTAGGTTTGCGTCGCTACGACGACGCCGTTT
CGGCGTACAACAAGGGTCTTGAGATTGACCCCAATAATGATGCTCTTAAATCTGGGCTTGCTGATGCTCAATCTGCTCAGGCCCGATCCA
GGCCCGCGCAGCAACCTCCAAGCCCGTTTGGGGATGTTTTCTCCGGGACGGAGATGTGGGCGAAGCTTACGGCGGATCCCTCAACGCGGG
CTTTGCTCCAGCAGCCTGATTTTGXTGAGGACCATGCAGGATATTCAGAAAAATCCCAGCAGTTTGAATACGTATCTCAAGGACCAGAGG
GTAATGCAGGCTCTCGGGGTGTTGTTGGGCTTGAAGTTGAATGcGAGAGGTGGGCCAGAAGAAGATACCGAAATGCCCGAGTCGTCGCCG
GAGCGCAAGAGGCCTGCGGAGGCTGAGCCTGTGAAGGAGGAGAAGAGACCTGAGAAGGCGCCCGAGCCGGAACCGGAACCAATGGAGCTT
TCAGGGGAAGTGAAGGAGGTTAAGGTGAGGAAAGCCCAGGCCCATAAGGAGAAGGAAGCTGGGAATGCTGCCTATAAAAAGAAGGATTTC
GAAGCTGCAATCCAACATTACACTAAAGCTTTTGAGCTTGATGATGAGGATATTTCCTTCCTCACCAATAGGGCAGCACTGTACTTGGAA
ATGGGGAAGTATGAGGATTGCATTAAAGACTGTGACAAAGCAGTTGAAAGAGGAAGAGAGCTGAGGTCAGACTTCAAGATGATCGCAAGG
GCTCTGACAAGAAAGGGAACTGCCTTAGTCAAGATGGCAAAATGTTCAAAGGATTATGAACCTGCTATTGAGACTTTCCAGAAGGCACTG
ACAGAGCACCGCAATCCTGACACACTGAAGAAGCTCAATGAAGCTGAGAAGGCAAAGAAAGAACTAGAGCAACAGGAGTATTTTGATCCA
CAGATAGCTGATGAGGAGCGTGAAAAAGGGAATCAGTATTTTAAAGAGCAGAAGTTCCCAGAAGCTGTCAAGCACTACACAGAATCCATC
AAGAGGAACCCAAAAGATCCAAGGGCTTATAGTAACAGGGCTGCTTGCTATACAAAGCTAACGGCTTTACCTGAGGGATTGAAAGATGCT
GAAAAGTGCATTGAGCTTGATCCAACATTTGTCAAGGGGTATACAAGAAAGGGTGCTGCCCAGTTTTTGATGAAAGAATATGAAAAGGCT
TTAGAAACATACCAGGAAGGATTGAAGCTTGATCGNCACAACCAGGAATTGCTAGATGGCGTTAGAAGATGTGTAGAACAAATTAACAAG
GCAAGCCGCGGGGATCTAACCCCTGAGGAGCTXAAAGAAAGACAGGCCAAGGGCATGCAGGATCCTGAAATCCAAAATATCCTCACTGAT
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan