ESTScan Details for Unigene SGN-U300401

Score 
336
Direction 
Forward
Predicted Peptide Sequence 
AAASELRIPKAAGIRTRDQFVYTPGEAVTAAQEVVTSMIAKGYILSKDAFAKAKAFDESYQVSSTAAAKVVELSNRIGLTDKINSGVEAV
KSVDKKYHVSETTMTAASYTGRTAVAAANAVVSSSYFATGALWVSSVLDRASKAAADLAKEVSESDFVRSKNVICSCNVDVCLTAISIFM
LMWKAVTTLTEIRFLLCDLKPSCKLQRPRYCAGHLVAIMAEYAIKNHGREG
Predicted Coding Sequence 
XXGGCGGCCGCATCAGAACTCCGGATCCCAAAAGCTGCAGGAATTCGGACGAGGGATCAGTTTGTATATACACCTGGAGAAGCTGTAACC
GCAGCACAAGAAGTAGTTACATCCATGATAGCAAAGGGTTACATTTTGAGTAAAGATGCCTTTGCAAAAGCCAAAGCTTTTGATGAGTCC
TATCAGGTCTCATCTACTGCAGCAGCTAAGGTGGTGGAGCTTAGCAACAGAATTGGGCTGACTGATAAAATTAATTCAGGTGTGGAGGCT
GTCAAATCTGTAGACAAGAAATACCATGTCTCTGAGACTACGATGACAGCTGCATCATATACTGGAAGAACAGCTGTAGCTGCTGCAAAT
GCTGTGGTTAGTAGCAGTTACTTTGCCACGGGAGCTCTCTGGGTTTCCAGCGTTCTAGACCGTGCGTCCAAAGCTGCTGCTGATTTGGCT
AAAGAGGTGTCAGAAAGTGACTTTGTGCGATCCAAGAATGTGATTTGTAGCTGTAATGTTGATGTATGTCTAACCGCCATCTCGATCTTT
ATGTTGATGTGGAAAGCTGTTACAACTCTCACAGAAATTAGATTCCTATTATGTGATCTGAAGCCATCGTGTAAGTTGCAACGCCCTAGA
TATTGTGCCGGACACTTGGTTGCAATAATGGCTGAGTATGCCATTAAAAACCACGGTCGTGAGGGGTAG
Edits in Original Sequence 
(5')XXGGCGGCCGCATCAGAACaTCCGGATCCCAAAAGCTGCAGGAATTCGGACGAGGGATCAGTTTGTATATACACCTGGAGAAGCTG
TAACCGCAGCACAAGAAGTAGTTACATCCATGATAGCAAAGGGTTACATTTTGAGTAAAGATGCCTTTGCAAAAGCCAAAGCTTTTGATG
AGTCCTATCAGGTCTCATCTACTGCAGCAGCTAAGGTGGTGGAGCTTAGCAACAGAATTGGGCTGACTGATAAAATTAATTCAGGTGTGG
AGGCTGTCAAATCTGTAGACAAGAAATACCATGTCTCTGAGACTACGATGACAGCTGCATCATATACTGGAAGAACAGCTGTAGCTGCTG
CAAATGCTGTGGTTAGTAGCAGTTACTTTGCCACGGGAGCTCTCTGGGTTTCCAGCGTTCTAGACCGTGCGTCCAAAGCTGCTGCTGATT
TGGCTAAtAGAGGTGTCAGAAAGTGACTTTGTGCGATCCAAGAATGTGATTTGTAGCTGTAATGTTGATGTATGTCTAACCGCCATCTCG
ATCTTTATGTTGATGTGGAAAGCTGTTACAACTCTCACAGAAATTAGATTCCTATTATGTGATCTGAAGCCATCGTGTAAGTTGCAACGC
CCTAGATATTGTGCCGGACACTTGGTTGCAATAATGGCTGAGcTATGCCATTAAAAACCACGGTCGTGAGGGGTAG(3')AGATTCTCTT
TCTAGTTAAACATGTTTTAAAGACTGCCAGGCATGACGTGCCTCCACGAAATGGGCCTTGCTACCTGTTTGATGTGTGAGCATCTATTCT
AACGAAGTGGGTGAGAGAACAATCTCGATCAAGTGCCCTCGCAGTCTGGCATCAGTTAGTCACCTTTAGTGTTTGGCCTTTCTTGGTGAT
ATATGCATGTTTAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan