ESTScan Details for Unigene SGN-U300430

Score 
88
Direction 
Forward
Predicted Peptide Sequence 
LVVNYELPVRFNNLSEPDYEVYLHRVGRAGRFGRKGAVFNLLCGDRDRRVMEKIESYFNCQVAEVGSWNSDEDFEDALKKAGLIDGMLRS
QSIDFQLLKWLCFFVPKAGHHAAERGENYGSFESSDXKFGRMTEEVRPFNFVPRTETEYLWYSILKVSCAGGVYDAGQVVVIKTYKIXGF
PISDSGLLSIAV
Predicted Coding Sequence 
XXCTTGGTAGTCAATTATGAACTCCCGGTCAGATTTAACAATTTGTCAGAGCCAGATTACGAGGTGTACCTTCATCGGGTTGGTAGAGCA
GGCCGTTTTGGCCGCAAAGGTGCTGTGTTTAACTTACTTTGCGGTGATAGAGACAGGAGGGTGATGGAAAAGATTGAGAGTTACTTTAAC
TGCCAAGTAGCTGAGGTGGGATCGTGGAACAGTGATGAAGACTTCGAGGATGCACTTAAAAAAGCGGGGCTGATTGATGGCATGCTACGC
TCTCAGTCAATTGATTTCCAACTTCTCAAGTGGCTCTGTTTTTTTGTTCCTAAAGCCGGGCATCACGCGGCAGAAAGGGGTGAGAATTAT
GGTAGTTTCGAGTCTTCTGATXCTAAATTTGGAAGAATGACAGAAGAAGTCCGACCTTTCAATTTTGTACCGAGAACAGAAACGGAGTAT
TTATGGTACTCGATATTAAAAGTGAGTTGTGCTGGTGGTGTTTACGATGCTGGTCAAGTGGTTGTGATAAAGACGTATAAGATTCXGGGA
TTTCCAATTTCTGATTCTGGGCTTTTGTCCATAGCTGTTTAG
Edits in Original Sequence 
(5')XXCTTGGTAGTCAATTATGAACTCCCGGTCAGATTTAACAATTTGTCAGAGCCAGATTACGAGGTGTACCTTCATCGGGTTGGTAG
AGCAGGCCGTTTTGGCCGCAAAGGTGCTGTGTTTAACTTACTTTGCGGTGATAGAGACAGGAGGGTGATGGAAAAGATTGAGAGTTACTT
TAACTGCCAAGTAGCTGAGGTGGGATCGTGGAACAGTGATGAAGACTTCGAGGATGCACTTAAAAAAGCGGGGCTGATcTGATGGCATGC
TACGCTCTCAGTCAATTGATTTCCAACTTCTCAAGTGGCTCTGTTTTTTTGTTCCTAAAGCCGGGCATCACGCGGCAGAAAGGGGTGAGA
ATTATGGTAGTTTCGAGTCTTCTGATXCTAAATTTGGAAGAATGACAGAAGAAGTCCGACCTTTcCAATTTTGTACCGAGAACAGAAACG
GAGTATTTATGGTACTCGATATTAAAAGTGAGTTGTGCTGGTGGTGaTTTACGATGCTGGTCAAGTGGTTGTGATAAAGACGTATAAGAT
TCXGGGATTTCCAATTTCTGATTCTGGGCTTTTGTCCATAGCTGTTTAG(3')GCTCATGTAATTTAATGACGAGGAAATATGGAGGAGG
TTGCAGCTGCTGAAGTGTACGGTATGGAATTCCATGTATAATAAGGTTGTCTTGCAACAGCTCCAATATTAATATTATTGCAAAAGGATT
AAAAAGAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan