ESTScan Details for Unigene SGN-U300436

Score 
1270
Direction 
Forward
Predicted Peptide Sequence 
PQAALLITCGDDKTIKVWDAASGSKQYTFEGHEAPVYSVCPHYKENIQFIFSTALDGKIKAWLYDNLGSRVDYDAPGRWCTTMAYSADGT
RLFSCGTSKDGESHIVEWNESEGAVKRTYQGFRKRSLGVVQFDTTRNRFLAAGDDFSVKFWDMDNVQLLTTIDADGGLPASPRIRFNKEG
ILLAVSTNENGIKILANNDGLRLLRTFENLAYDASQAEAATKPSLNPIAAAATNSSGLADRVASVVSISAVNGESRNLGDVKPRLNEETN
DKSKIWKLTEISEPSQCRSLKLPENLRVTKISRLMYTNSGSAILALASNAIHLLWKWQRNDRNSSGKATASTSPQLWQPASGILMTNDVI
DSSPEEAIHCFALSKNDSYVMSASGGKISLFNMMTFKTMTTFMPPPPAATFLAFHPQDNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSK
RITGLAFSHVLNVLVSSGADAQLCVWNSDGWEKQKARFLQIPSGRTPMAQSDARVQFHQDQIHFLVVHETQLAIYETTKLECVKQWLPRE
SGAPISHATFSCDSQLVYASFLDAAXVRVHSNSLTNEMSLSPPAYLPNSISNSNVQPLVIAAHPQDPNQFAIGLSDGAVHVFEPLESDGR
WGVPPLVDNGSASSLPASAAGGSSSDQGRDDWIDGEMPILPGFVSWQAPSVAQEVEKFX
Predicted Coding Sequence 
CCACAAGCAGCTCTGCTGATAACATGTGGTGATGACAAGACAATTAAGGTTTGGGATGCGGCAAGTGGTTCAAAACAATATACCTTTGAA
GGTCATGAGGCTCCAGTTTATTCTGTGTGCCCCCACTACAAAGAAAATATTCAGTTTATCTTTTCAACAGCCCTAGATGGGAAAATTAAA
GCATGGTTATATGATAATTTGGGATCACGAGTTGACTATGATGCGCCTGGCCGTTGGTGTACAACAATGGCCTATAGTGCTGATGGAACG
AGGCTTTTTTCTTGTGGGACCAGCAAAGATGGGGAATCCCACATTGTTGAATGGAATGAAAGTGAAGGTGCTGTGAAGAGGACATACCAA
GGCTTTCGAAAACGTTCGCTGGGTGTTGTGCAGTTTGATACAACTAGGAACCGGTTTTTGGCAGCTGGTGATGATTTCTCCGTCAAGTTT
TGGGATATGGACAATGTTCAACTTCTGACAACTATTGATGCTGATGGAGGTCTCCCAGCAAGCCCTCGAATCAGGTTCAATAAAGAGGGC
ATCCTGTTGGCTGTTTCTACCAATGAAAATGGGATCAAAATTCTAGCAAATAATGATGGTCTTCGATTGCTGCGAACATTTGAAAATCTT
GCTTATGATGCATCACAAGCTGAGGCTGCAACCAAGCCCTCGTTGAATCCAATAGCAGCAGCAGCTACTAATAGTTCAGGACTTGCAGAC
AGGGTAGCCTCTGTTGTCAGTATTTCTGCAGTGAATGGAGAATCAAGAAACCTGGGAGATGTCAAACCTCGACTCAATGAAGAAACAAAT
GACAAATCCAAAATTTGGAAGCTCACCGAAATTAGTGAACCTTCTCAGTGCCGGTCATTGAAGCTTCCAGAGAATCTGAGGGTGACAAAG
ATATCAAGATTGATGTATACAAATTCAGGTAGTGCCATTTTAGCATTAGCATCAAATGCCATTCATCTGCTCTGGAAATGGCAGAGAAAT
GACCGTAATTCAAGTGGCAAGGCAACTGCCAGTACGTCCCCTCAATTATGGCAGCCAGCAAGTGGCATATTAATGACAAATGATGTAATT
GATTCGAGTCCTGAGGAGGCTATACACTGCTTTGCACTGTCTAAGAATGATTCTTATGTGATGTCAGCGTCAGGAGGAAAAATATCCCTG
TTCAATATGATGACATTTAAGACAATGACAACTTTCATGCCTCCACCTCCTGCAGCTACTTTCTTAGCATTTCATCCTCAAGATAACAAC
ATTATTGCTATTGGCATGGATGACTCAACTATTCAGATATACAACGTTCGTGTAGATGAGGTGAAAAGCAAGCTAAAAGGCCATTCTAAA
AGAATTACTGGCCTTGCTTTCTCCCATGTACTAAATGTGTTAGTCTCATCAGGAGCAGATGCGCAGCTATGTGTGTGGAACTCGGATGGA
TGGGAAAAGCAAAAGGCTAGATTTTTGCAAATTCCTTCAGGCAGGACACCTATGGCACAATCGGACGCTCGTGTGCAGTTCCATCAGGAT
CAGATTCACTTCCTGGTTGTCCACGAGACTCAGCTTGCCATATATGAGACAACAAAACTGGAATGTGTCAAGCAGTGGCTTCCGCGTGAA
TCTGGTGCTCCAATTTCTCATGCAACATTCTCTTGCGATAGCCAGCTGGTGTATGCCAGCTTCTTAGATGCTGCAGXTGTGCGTGTTCAC
AGCAACTCACTTACAAATGAGATGTCGTTAAGTCCTCCTGCTTATCTTCCCAACAGTATAAGCAACTCCAATGTCCAGCCACTTGTAATT
GCTGCACATCCACAGGATCCAAACCAGTTTGCTATAGGTTTATCAGATGGTGCGGTCCATGTTTTTGAGCCCCTTGAATCTGATGGCAGA
TGGGGTGTCCCTCCACTGGTCGATAATGGATCTGCAAGCAGTTTACCAGCGAGTGCAGCTGGAGGCTCCAGCTCTGATCAGGGCAGAGAT
GACTGGATAGACGGGGAAATGCCAATTTTACCTGGTTTTGTTTCTTGGCAAGCTCCATCTGTTGCACAAGAAGTAGAAAAATTTGXX
Edits in Original Sequence 
ATTCGGCACGAGGCC(5')CCACAAGCAGCTCTGCgTGATAACATGTGGTGATGACAAGACAATTAAGGTTTGGGATGCGGCAAGTGGTT
CAAAACAATATACCTTTGAAGGTCATGAGGCTCCAGTTTATTCTGTGTGCCCCCACTACAAAGAAAATATTCAGTTTATCTTTTCAACAG
CCCTAGATGGGAAAATTAAAGCATGGTTATATGATAATTTGGGATCACGAGTTGACTATGATGCGCCTGGCCGTTGGTGTACAACAATGG
CCTATAGTGCTGATGGAACGAGGCTTTTTTCTTGTGGGACCAGCAAAGATGGGGAATCCCACATTGTTGAATGGAATGAAAGTGAAGGTG
CTGTGAAGAGGACATACCAAGGCTTTCGAAAACGTTCGCTGGGTGTTGTGCAGTTTGATACAACTAGGAACCGGTTTTTGGCAGCTGGTG
ATGATTTCTCCGTCAAGTTTTGGGATATGGACAATGTTCAACTTCTGACAACTATTGATGCTGATGGAGGTCTCCCAGCAAGCCCTCGAA
TCAGGTTCAATAAAGAGGGCATCCTGTTGGCTGTTTCTACCAATGAAAATGGGATCAAAATTCTAGCAAATAATGATGGTCTTCGATTGC
TGCGAACATTTGAAAATCTTGCTTATGATGCATCACAAGCTGAGGCTGCAACCAAGCCCTCGTTGAATCCAATAGCAGCAGCAGCTACTA
ATAGTTCAGGACTTGCAGACAGGGTAGCCTCTGTTGTCAGTATTTCTGCAGTGAATGGAGAATCAAGAAACCTGGGAGATGTCAAACCTC
GACTCAATGAAGAAACAAATGACAAATCCAAAATTTGGAAGCTCACCGAAATTAGTGAACCTTCTCAGTGCCGGTCATTGAAGCTTCCAG
AGAATCTGAGGGTGACAAAGATATCAAGATTGATGTATACAAATTCAGGTAGTGCCATTTTAGCATTAGCATCAAATGCCATTCATCTGC
TCTGGAAATGGCAGAGAAATGACCGTAATTCAAGTGGCAAGGCAACTGCCAGTACGTCCCCTCAATTATGGCAGCCAGCAAGTGGCATAT
TAATGACAAATGATGTAATTGATTCGAGTCCTGAGGAGGCTATACACTGCTTTGCACTGTCTAAGAATGATTCTTATGTGATGTCAGCGT
CAGGAGGAAAAATATCCCTGTTCAATATGATGACATTTAAGACAATGACAACTTTCATGCCTCCACCTCCTGCAGCTACTTTCTTAGCAT
TTCATCCTCAAGATAACAACATTATTGCTATTGGCATGGATGACTCAACTATTCAGATATACAACGTTCGTGTAGATGAGGTGAAAAGCA
AGCTAAAAGGCCATTCTAAAAGAATTACTGGCCTTGCTTTCTCCCATGTACTAAATGTGTTAGTCTCATCAGGAGCAGATGCGCAGCTAT
GTGTGTGGAACTCGGATGGATGGGAAAAGCAAAAGGCTAGATTTTTGCAAATTCCTTCAGGCAGGACACCTATGGCACAATCGGACGCTC
GTGTGCAGTTCCATCAGGATCAGATTCACTTCCTGGTTGTCCACGAGACTCAGCTTGCCATATATGAGACAACAAAACTGGAATGTGTCA
AGCAGTGGCTTCCGCGTGAATCTGGTGCTCCAATTTCTCATGCAACATTCTCTTGCGATAGCCAGCTGGTGTATGCCAGCTTCTTAGATG
CTGCAGXTGTGCGTGTTCACAGCAACTCACTTACAAATGAGATGTCGTaTAAGTCCTCCTGCTTATCTTCCCAACAGTATAAGCAACTCC
AATGTCCAGCCACTTGTAATTGCTGCACATCCACAGGATCCAAACCAGTTTGCTATAGGTTTATCAGATGGTGCGGTCCATGTTTTTGAG
CCCCTTGAATCTGATGGCAGATGGGGTGTCCCTCCACTGGTCGATAATGGATCTGCAAGCAGTTTACCAGCGAGTGCAGCTGGAGGCTCC
AGCTCTGATCAGGcGCAGAGATGACTGGATAGACGGGGAAATGCCAATTTTACCTGGTTTTGTTTCTTGGCAAGCTCCAtTCTGTTGCAC
AAGAAGTAGAAAAATTTGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan