ESTScan Details for Unigene SGN-U300447

Score 
468
Direction 
Forward
Predicted Peptide Sequence 
MKQKVVIRLSMNDEKXPQEAFKTVVGHAGVESTALQGKEKDQIEVVGDGIDAVKLATLLRKNVGFAELVTVSPVGEKKDGDKKEDGKKDP
SSTEPPVVWSTYPYVYSSYLTISIKLETPMMTPTAPSCKKAGHKKFGNFRVTIFFPVIQGKVKFRGAAKFWHGPLENWNEDENSIILGEG
KILGSVGGGXLFLGANKPVGAIA
Predicted Coding Sequence 
ATGAAGCAAAAAGTCGTGATTAGACTTTCTATGAATGATGAGAAGXTCCCGCAAGAAGCCTTCAAAACTGTTGTCGGTCACGCAGGTGTG
GAATCTACGGCTTTGCAGGGAAAGGAAAAGGATCAAATAGAGGTTGTTGGAGATGGGATTGATGCAGTGAAGCTTGCAACTTTGCTCAGA
AAAAATGTTGGGTTTGCAGAGCTTGTGACCGTGAGCCCAGTTGGTGAGAAGAAAGATGGTGATAAAAAAGAAGATGGCAAGAAAGATCCC
AGTTCTACGGAGCCACCTGTGGTTTGGTCCACTTATCCTTATGTTTACAGCAGCTACCTCACCATCTCTATCAAGCTAGAGACCCCTATG
ATGACTCCAACTGCACCATCATGTAAGAAAGCAGGACACAAGAAATTTGGGAATTTTAGGGTTACCATCTTTTTCCCAGTCATACAAGGA
AAAGTGAAGTTCAGGGGTGCTGCTAAATTTTGGCATGGTCCTCTAGAGAACTGGAATGAAGATGAGAATTCAATCATATTAGGTGAAGGG
AAGATACTTGGGTCCGTAGGGGGAGGAXCTCTGTTTCTTGGTGCTAATAAACCAGTTGGAGCTATTGCCTAG
Edits in Original Sequence 
CCTCGTGCCGAAAGAAGAACGACTTCTGCAGTCTCTTTTCTCAGCTAGAGCTGTTCATTTTTTTTTCAGTCGTTTTACTTGCGGAATTAA
GGCA
(5')ATGAAGCAAAAAGTCGTGATTAGACTTTCTATGAATGATGAGAAGXTCCCGCAAGAAgGCCTTCAAAACTGTTGTCGGTCAC
GCAGGTGTGGAATCTACGGCTTTGCAGGGAAAGGAAAAGGATCAAATAGAGGTTGTTGGAGATGGGATTGATGCAGTGAAGCTTGCAACT
TTGCTCAGAAAAAATGTTGGGTTTGCAGAGCTTGTGACCGTGAGCCCAGTTGGTGAGAAGAAAGATGGTGATAAAAAAGAAGATGGCAAG
AAAGATCCCAGTTCTACGGAGCCACCTGTGGTTTGGTCCACTTATCCTTATGTTTACAGCAGCgTACCTCACCATCTCTATCAAGCTAGA
GACCCCTATGATGACTCCAACTGCACCATCATGTAAGAAAGCAGGACACAAGAAATTTGGGAATTTTAGGGTTACCgATCTTTTTCCCAG
TCATACAAGGAAAAGTGAAGTTCAGGGGTGCTGCTAAATTTTaGGCATGGTCCTCTAGAGAACTGGAATGAAGATGAGAATTCAATCATA
TTaAGGTGAAGGGAAGATACTTGGGTCCGTAGGGGGAGGAXCTCTGTTTCTTGGTGCTAATAAACCAGTTGGAGCTATTGCCTAG(3')G
TCTAAATTTTGGCTTGTTTCAAGTAGTAGTTGGTTGGTTTGTATATTCGGTGGTTGTATTTGAGATCCTAGGAACAAGTGTTTCGATAAC
CAATATTTTGTTTCCAATCATAAATATATTTTTTAATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan