ESTScan Details for Unigene SGN-U300456

Score 
207
Direction 
Forward
Predicted Peptide Sequence 
LIQSLATRNSIVALDELGRGTSTSDGQAIAESVLDHFAHRVHCRGMFSTHYHRLAIDYERDPKVSLFHMACQVGRGIEGLEDVTFLYRLT
PGACPKSYGVNVARLAGLPDAVLQKATLKSRDFEETYGRIKGPKDIFSTHRKEELKNVMKNFQPLWPTTVAIKGGFYASRTARKSKVTSR
TKLKRQSLHCVVQYWLLLITWNEAQPAIGNFAPVLRYLFGVDFSPVAXVKKKKNAAIPRFTCFDLESXVADLWKRQRLRSKSHAEVCFSA
TFLTVPGWAHLXVRIEMDGNDFEGLFCLSLAISKPTKRLFAVRIYLTVGVTGAGGMICGIYFHLLFHLIYLASRESIADLIDCLIAXRVT
KDRAGEKVTRRIVKTLGSDCYCSSHLISVAVCREKLGTFLLQKPEKDVKWSVKSW
Predicted Coding Sequence 
XXGTTAATACAGTCATTGGCAACTAGAAATTCAATTGTTGCATTGGATGAGCTTGGACGAGGAACGTCAACTTCAGATGGACAAGCAATA
GCTGAATCTGTTCTTGATCACTTTGCCCACAGGGTACATTGTCGAGGAATGTTCTCTACTCATTATCATCGATTGGCTATTGACTATGAG
AGAGATCCCAAGGTTTCCCTGTTTCACATGGCATGCCAAGTTGGCAGAGGAATTGAAGGTCTGGAGGATGTTACATTTCTTTACAGGTTG
ACCCCTGGTGCGTGCCCCAAAAGTTATGGTGTCAATGTTGCAAGGCTAGCTGGACTTCCTGATGCTGTGCTCCAAAAGGCCACATTGAAG
TCTCGAGATTTTGAGGAAACCTATGGGAGAATAAAGGGACCGAAGGACATATTTTCAACTCATCGGAAAGAGGAGCTGAAAAATGTGATG
AAGAATTTTCAACCATTGTGGCCAACAACAGTTGCCATCAAAGGCGGTTTCTACGCTAGCCGAACTGCAAGGAAAAGCAAGGTTACTTCT
AGAACGAAGTTAAAAAGGCAATCACTCCATTGTGTTGTACAGTATTGGCTTCTTCTGATTACTTGGAATGAGGCACAACCGGCCATTGGC
AACTTTGCXCCAGTTCTGAGATATTTATTCGGAGTTGATTTCTCACCAGTTGCTXTGGTTAAAAAAAAAAAAAATGCTGCTATTCCACGT
TTTACCTGTTTTGACCTTGAAAGTGXTGTAGCGGACTTGTGGAAGCGGCAGCGCTTGCGGTCTAAATCACACGCAGAAGTTTGTTTCAGC
GCAACCTTTTTGACTGTACCTGGCTGGGCCCATCTTAXGGTGCGTATCGAAATGGACGGGAATGACTTTGAAGGGTTATTTTGTCTTTCC
CTTGCCATCTCAAAACCAACAAAAAGGTTGTTTGCGGTGAGGATCTATCTGACGGTCGGGGTTACTGGAGCCGGGGGCATGATTTGTGGA
ATTTACTTTCATTTGTTGTTCCATCTCATTTACCTTGCATCAAGGGAATCTATAGCTGATTTGATTGATTGTTTGATTGCTXCACGAGTA
ACAAAGGACAGAGCCGGGGAGAAAGTAACAAGGAGGATTGTCAAGACACTTGGGAGCGACTGCTACTGCTCATCTCATCTCATCTCCGTT
GCTGTCTGTCGTGAAAAACTGGGTACGTTTCTCCTTCAGAAACCTGAAAAAGATGTGAAATGGAGTGTGAAGTCGTGG
Edits in Original Sequence 
(5')XXGTTAATACAGTCATTGGCAACTAGAAATTCAATTGTTGCATTGGATGAGCTTGGACGAGGAACGTCAACTTCAGATGGACAAGC
AATAGCTGAATCTGTTCTTGATCACTTTGCCCACAGGGTACATTGTCGAGGAATGTTCTCTACTCATTATCATCGATTGGCTATTGACTA
TGAGAGAGATCCCAAGGTTTCCCTGTTTCACATGGCATGCCAAGTTGGCAGAGGAATTGAAGGTCTGGAGGATGTTACATTTCTTTACAG
GTTGACCCCTGGTGCGTGCCCCAAAAGTTATGGTGTCAATGTTGCAAGGCTAGCTGGACTTCCTGATGCTGTGCTCCAAAAGGCCACATT
GAAGTCTCGAGATTTTGAGGAAACCTATGGGAGAATAAAGGGACCGAAGGACATATTTTCAACTCATCGGAAAGAGGAGCTGAAAAATGT
GATGAAGAATTTaTCAACCATTGTGGCCAACAACAGTTGCCATCAAAGtGCGGTTTCTACGCTAGCCGAACTGCAAGGAAAAGCAAGGTT
ACTTCTAGAACGAAGTTAAAAAGGCAATCACTCCATTGTGTTGTACAGTATTGGCTTCTTCTGATTACTTGGAATGAGGCACAACCGGCC
ATTGGCAACTTTGCXCCAGTTCTGAGATATTTATTCGGcAGTTGATTTCTCACCAGTTGCTXTGGTTAAAAAAAAAAAAAATGCTGCTAT
TCCACGTTTTACCTGTTTTGACCTTGAAAGTGXTGTAGCGGACTTGTGGAAGCGGCAGCGCTTGCGGTCTAAATCACACGCAGAAGTTTG
TTTCAGCGCAACCTTTTTGACTGTACCTGGCTGGGCCCATCTTAXGGTGCGTATCGAAATGGACGGGAATGACTTTGAAGGGTTATTTTG
TCTTTCCCTTGCCATCTCAAAACCAACAAAAAGGTTGTTTGCGGTGAGGATCTATCTGACGGTCGGGGTTACTGGAGCCGGGGGCATGAT
TTGTGGAATTTACTTTCATTTGTTGTTCgCATCTCATTTACCTTGCATCAAGGGAATCTATAGCTaGATTTGATTGATTGTTTGATTGCT
XCACGAGTAACAAAGGACAGAGCCGGGGAGAAAGTAACAAGGAGGATTGTCAAGACACTTGGGAGCGACTGCTACTGCTCATCTCATCTC
ATCTCCGTTGCTGTCTGTCGTGAAAAACTGGGTACGTTTCTCCTTCAGAAACCTGAAAAAGATGTGAAATGGAGTGTGAAGTCGTGG(3')
TTCTTATAGCTTGTGTTGTTGGGTGTGTTCAGATGCATTGGTCTGTGTGTATGGTTTGTGTTCTCCTGTTTGGTCATTTCACTCTATAA
AAGTAAAGTAAAGTTGGTAAGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan