ESTScan Details for Unigene SGN-U300466

Score 
357
Direction 
Forward
Predicted Peptide Sequence 
MVEFLLDDYDCKVTVSLRYADLVSILPTGVSVLAWPMHRNFMNKKGGGPLGSKTIPERLSYAEDALRIMSLPEAYAEIVLKLPHALQEIY
PTMLLHNLSTSSXVESAEKWRDGLCIDIDLPVTVLVVPERSMHK
Predicted Coding Sequence 
ATGGTTGAATTTTTGCTTGACGATTATGATTGTAAGGTGACAGTAAGTCTTAGATATGCAGATCTTGTCTCTATACTTCCAACTGGAGTC
AGTGTCCTGGCATGGCCAATGCACAGGAATTTCATGAACAAGAAGGGAGGCGGACCATTAGGGAGTAAAACCATTCCAGAAAGGCTGTCT
TATGCAGAGGATGCTTTACGAATCATGAGTTTACCTGAAGCTTACGCAGAGATTGTTTTGAAGCTCCCTCATGCTCTGCAGGAGATATAT
CCCACAATGCTTCTTCATAATCTCTCAACTTCATCAXCTGTAGAGAGCGCTGAGAAATGGAGAGATGGTTTATGCATAGACATTGATTTG
CCAGTCACAGTGCTTGTTGTTCCTGAACGGAGTATGCATAAGTGA
Edits in Original Sequence 
CCATCTCTGTCTATGCTTGTTCCAAATTTACTTAATTAGATTCAAGATTATTTTAATCCCACTTTTCCTATTAGTGTTGAACTGGGCACC
AGAACATATTTCAAAAGTCAAAGGACAGTCTTGCAAATTTATTATTCTCCTGCAAATTTTGAGCATGTGAAATTCTTAACCTTTAAAAGT
TAGATTTGTACGAAAGTCCTTTTCATGATGGAGAGATGATATTTAGGCGCATGGTTGTGCAACAATGACAGTTCTATAGAAGGCTGATTA
CTTGATATTGACCACCTATTGTCTGTTTGGATGGTTGGAATGCTGCCACGTATTTCAGTGATATTAAATGGAAATTTCCTGAATTTAACA
TGTTATTATCTTCCCATTTCTTGTGATACATTTTTGAAATCAGTTTGGTCTATTTCCAGCTCCCTTTTCTTGTGGTTTTCAGGTTCGCCT
TATCAAGGAATTATACGGAAATCAAATCAAAGAACTTTACCATAGTCTTCCGTACCAC
(5')ATGGTTGAATTTTTGCTTGACGATTATG
ATTGTAAGGTGACAGTAAGTCTTAGATATGCAGATCTTGTCTCTATACTTCCAACTGGAGTCAGTGTCCTGGCATGGCCAATGCACAGGA
ATTTCATGAACAAGAAGGGAGGCGGACCATTAGGGAGTAAAACCATTCCAGAAAGGCTGTCTTATGCAGAGGATGCTTTACGAATCATGA
GTTTACCTGAAGCTTACGCAGAGATTGTTTTGAAGCTCCCTCATGCTCTGCAGGAGATATATCCgCACAATGCTTCTTCATAATCTCTCA
ACTTCATCAXCTGTAGAGAGCGCTGAGAAATGGAGAGATGGTTTATGCATAGACATTGATTTGCCAGTCACAGTGCTTGTTGTTCCTGAA
CGGAGTATGCATAAGTGA(3')ATTTTGAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan