ESTScan Details for Unigene SGN-U300567

Score 
554
Direction 
Forward
Predicted Peptide Sequence 
VCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIFVKSVNRAAELNKLLVECNFPSXLHSFGHVPGRKV
DTLQGFQGGAKRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQ
IDTSTYCPRDDVTEFLCGKIGNDVQVTELLFASL
Predicted Coding Sequence 
GTTTGCAAGAAGTTTATGCAAGATCCGATGGAAATCTATGTGGACGACGAAGCCAAGTTGACCCTTCATGGTCTTGTACAGCATTACATC
AAGTTGAGTGAACTCGAGAAAAACCGGAAGTTGAATGACCTGCTTGATGCGTTGGACTTTAACCAAGTTGTCATATTTGTCAAAAGCGTG
AACCGAGCTGCTGAGCTGAACAAATTGCTTGTGGAATGTAATTTCCCATCTXATCTGCATTCATTCGGGCATGTCCCAGGAAGAAAGGTT
GACACGCTACAAGGGTTTCAAGGAGGGGCTAAGAGGATTCTTGTGGCGACAGATTTGGTTGGTAGGGGAATTGACATTGAGAGGGTTAAC
ATTGTCATTAACTATGACATGCCAGATTCTGCAGACACTTATTTGCACAGGGTTGGTAGAGCTGGTAGATTTGGCACAAAAGGTCTTGCC
ATTACGTTTGTTTCATCAGCATCTGATTCTGATGTCCTCAATCAGGTTCAGGAGAGGTTTGAAGTGGATATAAAGGAGCTTCCTGAGCAG
ATTGATACTTCTACATATTGCCCTCGTGATGACGTGACGGAGTTCTTATGTGGCAAAATTGGAAATGATGTCCAAGTTACTGAACTTTTG
TTCGCATCACTTTGA
Edits in Original Sequence 
(5')GTTTGCAAGAAGTTTATGCAAGATCCGATGGAAATCTATGTGGACGACGAAGCCAAGTTGACCCTTCATGGTCTTGTACAGCATTA
CATCAAGTTGAGTGAACTCGAGAAAAACCGGAAGTTGAATGACCTGCTTGATGCGTTGGACTTTAACCAAGTTGTCATATTTGTCAAAAG
CGTGAACCGAGCTGCTGAGCTGAACAAATTGCTTGTGGAATGTAATTTCCCATCTXATCTGCATTCATTCGGGCATGTCCCAGGAAGAAA
GGTTGACACGCTACAAGGGTTTCAAGGAGGGGCaTAAGAGGATTCTTGTGGCGACAGATTTGGTTGGTAGGGGAATTGACATTGAGAGGG
TTAACATTGTCATTAACTATGACATGCCAGATTCTGCAGACACTTATTTGCACAGGGTTGGTAGAGCTGGTAGATTTGGCACAAAAGGTC
TTGCCATTACGTTTGTTTCATCAGCATCTGATTCTGATGTCCTCAATCAGGTTCAGGAGAGGTTTGAAGTGGATATAAAGGAGCTTCCTG
AGCAGATTGATACTTCTACATATaTGCCCTCGTGATGACGTGACGGAGTTCTTATGTGGCAAAATTGGAAATGATGTCCAAGTTACTGAA
CTTTTGTTCGCATCACTTTGA(3')GAATTCGACTGAGTTGATTGCTAGAGAACTGTTCTATTGTTTGCACCTTGCTACTGAGATTCTTG
TATCTTATTTAGACTTATATGGTTTGGCAGCTTAGAGAGGATTTAAAAATGTGTTACAATACGACTTGCTAGATATTATTCTCCAGTTGT
CCCTAGATAATCCTTTAAACTTTTGTTTTTGTTTTTTTTTTTTTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan