ESTScan Details for Unigene SGN-U300824

Score 
314
Direction 
Forward
Predicted Peptide Sequence 
DTPNTLASLPPLTLTXLEKGPKRTPKNIRSRKSHTLPPLKFYSHFLSPPQNAANSSGHGGRCSGGFFLGTNTPPSPTEAHNITKILAEFP
EFSTFNHFLTTTHLANDINNRETITVCAVDNAGMADLLGKHLSIFALKNVLSLHVLLDYFGAKKLHDITNGTALAATMYQATGSAPGSSG
FVNITDLKGGKVGFGAVDNGGIDATFVKSVKEIPYNISVIQISKILPSPDAEAPTPGPSQMNITGIMSAHGCKVFAETLLASPAEQTFDS
SVDGGLTIFCPGDAAMKSFLPKFKNLTADGKQSLLEFHGVPIYEPESSLKSNNGPINTLATDGAKKFGLVVQNDGQQXDAEDATRDGEDN
VDDFDEQPLAIFELDKVLLPRELFKGSLAPTPAPAPAPGPVADAPEPSKKHKSPPAPPAAGSPADGPAAGSNSSGR
Predicted Coding Sequence 
XGGGACACACCGAACACACTTGCCTCTCTCCCTCCTCTCACTCTCACTXCACTAGAAAAAGGCCCTAAAAGAACCCCCAAAAACATCCGC
AGCCGCAAGTCCCATACGCTCCCGCCTCTCAAATTCTACTCCCATTTTCTATCTCCACCACAAAATGCAGCTAACTCCAGCGGCCATGGT
GGCCGCTGCAGCGGTGGTTTTTTCCTTGGCACTAATACTCCTCCTTCCCCAACTGAAGCTCACAACATTACTAAGATTTTAGCAGAGTTC
CCAGAATTCTCCACGTTCAACCATTTCTTAACCACAACCCACCTCGCTAACGACATTAACAACCGAGAGACCATCACTGTCTGCGCCGTC
GACAATGCCGGCATGGCAGATCTACTCGGCAAACACTTGTCCATCTTCGCCTTAAAAAATGTCCTCTCCCTCCACGTCCTTCTCGACTAT
TTCGGCGCCAAGAAGCTTCACGATATCACCAACGGAACCGCCTTGGCTGCCACCATGTACCAAGCCACCGGCAGCGCTCCCGGCTCCTCC
GGCTTCGTCAACATTACTGACCTTAAGGGCGGTAAAGTGGGCTTCGGCGCCGTCGACAATGGCGGAATCGACGCCACATTTGTGAAATCT
GTCAAGGAAATTCCTTACAACATTTCCGTAATTCAGATCAGTAAGATCTTGCCGTCTCCCGACGCCGAAGCGCCCACTCCTGGGCCCAGC
CAGATGAACATCACGGGTATCATGTCAGCTCACGGCTGTAAAGTTTTCGCCGAGACTTTATTAGCTTCTCCAGCTGAGCAGACATTCGAC
AGCAGTGTTGACGGTGGGTTAACGATTTTTTGCCCGGGTGACGCTGCAATGAAGAGCTTTTTACCCAAATTCAAAAACTTAACGGCGGAC
GGTAAACAGTCGTTACTCGAGTTTCACGGCGTTCCGATTTACGAGCCCGAGTCATCTTTGAAATCCAATAACGGCCCTATTAACACGTTA
GCCACTGACGGCGCTAAAAAGTTCGGCCTCGTTGTGCAAAATGACGGCCAGCAGGXTGACGCTGAAGACGCCACTCGTGACGGCGAGGAT
AACGTCGACGATTTCGATGAACAGCCGTTGGCTATATTTGAGCTGGATAAGGTCTTGTTGCCCAGGGAGTTGTTCAAGGGTTCTCTGGCT
CCGACTCCGGCACCGGCGCCGGCACCGGGACCGGTGGCTGATGCTCCCGAGCCTTCGAAGAAGCACAAGTCGCCGCCTGCACCGCCTGCC
GCAGGTTCTCCTGCAGACGGCCCTGCTGCXGGATCAAACAGCAGCGGACGTTAA
Edits in Original Sequence 
(5')XGGGACACACCGAACACACTTGCCTCTCTCCCTCCTCTCACTCTCACTXCACTAGAAAAAGGCCCTAAAAGAACCCCCAAAAACAT
CCGCAGCCGCAtAGTCCCATACGCTCCCGCCTCTCAAATTCTACTCCCATTTTCTATCTCCACCACAAAATGCAGCTAACTCCAGCGGCC
ATGGTGGCCGCTGCAGCGGTGGTTTTTTCCTTGGCACTAATACTCCTaCCTTCCCCAACTGAAGCTCACAACATTACTAAGATTTTAGCA
GAGTTCCCAGAATTCTCCACGTTCAACCATTTCTTAACCACAACCCACCTCGCTAACGACATTAACAACCGAGAGACCATCACTGTCTGC
GCCGTCGACAATGCCGGCATGGCAGATCTACTCGGCAAACACTTGTCCATCTTCGCCTTAAAAAATGTCCTCTCCCTCCACGTCCTTCTC
GACTATTTCGGCGCCAAGAAGCTTCACGATATCACCAACGGAACCGCCTTGGCTGCCACCATGTACCAAGCCACCGGCAGCGCTCCCGGC
TCCTCCGGCTTCGTCAACATTACTGACCTTAAGGGCGGTAAAGTGGGCTTCGGCGCCGTCGACAATGGCGGAATCGACGCCACATTTGTG
AAATCTGTCAAGGAAATTCCTTACAACATTTCCGTAATTCAGATCAGTAAGATCTTGCCGTCTCCCGACGCCGAAGCGCCCACTCCTGGG
CCCAGCCAGATGAACATCACGGGTATCATGTCAGCTCACGGCTGTAAAGTTTTCGCCGAGACTTTATTAGCTTCTCCAGCTGAGCAGACA
TTCGACAGCAGTGTTGACGGTGGGTTAACGATTTTTTGCCCGGGTGACGCTGCAATGAAGAGCTTTTTACCCAAATTCAAAAACTTAACG
GCGGACGGTAAACAGTCGTTACTCGAGTTTCACGGCGTTCCGATTTACGAGCCCGAGTCATCTTTGAAATCCAATAACGGCCCTATTAAC
ACGTTAGCCACTGACGGCGCTAAAAAGTTCGGCCTCGTTGTGCAAAATGACGGCCAGCAGGXTGACGCTGAAGACGCCACTCGTGACGGC
GAGGATAACGTCGACGATaTTCGATGAACAGCCGTTGGCTATATTTGAGCTGGATAAGGTCTTGTTGCCCAGGGAGTTGTTCAAGGGTTC
TCTGGCTCCGACTCCGGCACCGGCGCCGGCACCGGGACCGGTGGCTGATGCTCCCGAGCCTTCGAAGAAGCACAAGTCGCCGCCTGCACC
GCCTGCCGCAGGTTCTCCTGCAGACGGCCCTGCTGCXGGATCAAACAGCAGCGGACGTTAA(3')CGGTGCCGTTAGATTTGACGGTGGA
AGATTTGTAGCTGTTTGTTTCAGTCTGTGGCTCATTATTTTACTTCTCTAAGATTTTCCCCTTTTCTTTTATGTTTTTTGACACCTCTTT
CTTTCAAAGGGGGTCAAATAATTTAAGGGCGTGTTTGGCTAGGGGTAGTAATTTATTTGTATTTAAATACGTTAGTTTGAGGGTCTTTAT
TTATTAGTAGTATGAGTGTGCATTTTGTTATTTCCACTTTTTTTTATTTTTTCCTTTTTCGGGTGGGGATCGTTTGATGTATTTTAGTGG
TGCCTGAGCGGAGTGAGGATTTTGCGCGGTGGTCATG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan