Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U300938

Score 
257
Direction 
Forward
Predicted Peptide Sequence 
AGPSSSGPGGXGTGGRSQSVGAAKXLTTTAAATPPPQDKLYSNSKLDTRQTVEQVVERELKKGTPTADQKKETNKQELARRRNSFDILRL
SGCENERXPGSLSASPSATELWVKLAYSSPTPAIPFPXDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAF
SLVSKASYENVSKKWIPELRHYAPGVPVILVGTKLDLRDDKQFFVDHPGAVPITTAQGEELRKLIGAASYIECSAKTQQNVKGVFDAAIK
VVLQPPKHKKKKKRKGQKGCSXIVSGRSNLEEYILLLTAALTDFSMELFLIARQAQRATGLLLVSTDFTRKFPFKLKVVDLPLSVAMLNV
SCESKMSAW
Predicted Coding Sequence 
GCAGGGCCGTCCTCGTCTGGTCCTGGTGGAXCTGGGACTGGGGGAAGGAGTCAGTCTGTGGGAGCTGCTAAGXTGCTAACTACTACCGCT
GCTGCCACTCCACCACCACAAGATAAACTTTACTCAAACTCAAAGTTGGATACTCGGCAAACTGTTGAACAAGTAGTGGAGCGAGAGCTC
AAGAAGGGAACTCCCACTGCTGATCAAAAAAAAGAAACAAACAAGCAAGAATTGGCCCGCCGGAGGAATAGTTTTGACATTTTGAGGCTT
TCAGGCTGCGAGAATGAGCGCGXTCCAGGTTCATTAAGTGCGTCACCGTCGGCGACGGAGCTGTGGGTAAAACTTGCCTACTCATCTCCT
ACACCAGCAATACCTTTCCCAXCTGATTATGTGCCGACTGTGTTTGACAATTTCAGTGCAAATGTGGTAGTGGATGGGAGCACTGTAAAT
CTAGGGTTGTGGGATACTGCAGGGCAGGAAGATTACAATAGATTAAGACCCTTGAGCTATCGCGGTGCAGATGTCTTTATTCTTGCATTT
TCTCTTGTTAGCAAGGCCAGTTACGAGAATGTCTCAAAAAAGTGGATTCCTGAATTGAGGCATTATGCTCCTGGAGTACCAGTAATCCTT
GTTGGAACAAAACTTGATCTCCGGGATGATAAGCAGTTTTTTGTAGATCATCCAGGAGCAGTGCCCATCACCACAGCTCAGGGGGAGGAG
CTGAGAAAGCTGATTGGGGCTGCTTCATACATTGAGTGTAGTGCAAAAACGCAACAGAATGTGAAAGGTGTATTTGATGCCGCCATTAAG
GTGGTTCTGCAGCCCCCGAAGCATAAGAAGAAAAAGAAGAGAAAGGGTCAAAAAGGCTGTAGTAXTATTGTGAGTGGCAGGAGTAATTTG
GAGGAATACATTTTACTGTTGACTGCAGCATTAACTGATTTCTCTATGGAGCTTTTCCTCATCGCAAGGCAGGCCCAGCGAGCTACXGGT
TTATTATTAGTCTCAACTGACTTTACTAGGAAGTTCCCCTTTAAGCTCAAAGTTGTTGACTTGCCACTGTCAGTTGCAATGCTGAATGTA
TCTTGCGAATCAAAGATGTCTGCATGG
Edits in Original Sequence 
CTCTCTCCCATTTTCTTAACTCTGTTTTTATTTTTTGATTTTAACTCTGTATTTTAATTTTCTGGGTTGGTTTGGGAGG(5')GCAGGGC
CGTCCTCGTCTGGTCCTGGTGGAXCTGGGACTGGGGGAAGGAGTCAGTCTGTGGGAGCTGCTAAGXTGCTAACTACTACCGCTGCTGCCA
CTgCCACCACCACAAGATAAACTTTACTCAAACTCAAAGTTGGATACTCGGCAAACTaGTTGAACAAGTAGTGGAGCGAGAGCTCAAGAA
GGGAACTCCCACgTGCTGATCAAAAAAtAAGAAACAAACAAGCAAGAATTGGCCCGCCGGAGGAATAGTTTTGACATTTTGAGGCTTTCA
GGCTGCGAGAATGAGCGCGXTCCAGGTTCATTAAGTGCGTCACCGTCGGCGACGGAGCTGTGGGTAAAACTTGCCTACTCATCTCCTACA
CCAGCAATACCTTTCCCAXCTGATTATGTGCCGACTGTGTTTGACAATTTCAGTGCAAATGTGGTAGTGGATGGGAGCACTGTAAATCTA
GGGTTGTGGGATACTGCAGGGCAGGAAGATTACAATAGATTAAGACCCTTGAGCTATCGCGGTGCAGATGTCTTTATTCTTGCATTTTCT
CTTGTTAGCAAGGCCAGTTACGAGAATGTCTCAAAAAAGTGGATTCCTGAATTGAGGCATTATGCTCCTGGAGTACCAGTAATCCTTGTT
GGAACAAAACTTGATCTCCGGGATGATAAGCAGTTTTTTGTAGATCATCCAGGAGCAGTGCCCATCACCACAGCTCAGGGGGAGGAGCTG
AGAAAGCTGATTGGGGCTGCTTCATACATTGAGTGTAGTGCAAAAACGCAACAGAATGTGAAAGGTGTATTTGATGCCGCCATTAAGGTG
GTTCTGCAGCCCCCGAAGCATAAGAAGAAAAAGAAGAGAAAGGGTCAAAAAGGCTGTAGTAXTATTGTGAGTGGCAGGAGTAATTTGGAG
GAATACATTTTACTGTTGACTGCAGCATTAAtCTGATTTCTCTATGGAGCTTTTCCTCATCGCAAGGCAGGCCCAGCGAGCTACXGGTTT
ATTATTAGTCTCAACTGACTTTACTAGGAAGTTCCCCTTTAAGCaTCAAAGTTGTTGACTTGCCACTGTCAGTTGCAATGCTGAATGTAT
CTTGCGAATCAAAGATGTCTGCATGG(3')TAGTTTGAACAGTCCCTCTACCTTATGATGCTAAATACGTATGTATAATGTTGTCATGTC
ATATATAACTTGTACTAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan