ESTScan Details for Unigene SGN-U300965

Score 
582
Direction 
Forward
Predicted Peptide Sequence 
VQLSQELGKATTLFPGIPLIDLSKPDSKHLLVKACEEFGFCKVINHGVPTEFISKLESEAIKFFSLPLSEKEKAGPPDPFGYGNKMIGPN
GDVGWVEYILLTTNPGFNYQKFESVFGVTPEKFQGAVNDYISAVKNMACSILEQLAEGLNIQPQTVFSKLLMDEQSDSVFRLNHYPPCPD
LQELHGRNLIGFGEHTDPQIISVLRSNNTSGLQIALKDGSWISVPPDQNSFFINVGDSMQVLTNGRFKSVRHRXIGQQFQIKGLNDLFGG
PPLSEKIAPLPSLMEGEDSLYKEFTWF
Predicted Coding Sequence 
GTTCAGCTTAGTCAAGAACTCGGTAAAGCTACCACATTATTCCCTGGGATTCCATTGATAGACCTCTCAAAACCGGACTCCAAGCACCTT
CTTGTGAAGGCGTGCGAAGAATTTGGATTCTGTAAAGTCATCAATCATGGTGTTCCCACTGAATTCATATCCAAACTTGAGTCTGAAGCC
ATCAAGTTCTTCTCTTTGCCCCTCTCTGAGAAGGAAAAAGCGGGGCCCCCTGACCCTTTCGGCTATGGTAACAAGATGATTGGGCCAAAT
GGCGACGTGGGTTGGGTTGAATACATCCTCTTAACGACCAACCCTGGATTCAATTACCAAAAGTTCGAATCAGTTTTTGGCGTCACCCCA
GAGAAGTTTCAGGGTGCTGTAAATGATTATATATCGGCAGTGAAGAACATGGCCTGTTCAATTCTCGAACAATTGGCTGAAGGGTTGAAT
ATTCAGCCACAGACTGTGTTCAGCAAGCTGTTGATGGATGAACAGAGTGACTCTGTTTTCAGGCTAAATCACTACCCACCCTGCCCTGAC
CTTCAAGAACTGCATGGCAGGAATTTAATTGGATTTGGAGAACACACTGACCCACAAATCATATCTGTTTTGCGATCCAACAACACTTCT
GGCCTTCAAATCGCATTGAAGGATGGAAGTTGGATTTCAGTTCCACCTGATCAAAATTCTTTCTTTATCAACGTTGGTGACTCAATGCAG
GTTTTGACAAATGGGAGGTTTAAAAGTGTGAGGCATAGAGXTATTGGCCAACAGTTCCAAATCAAGGGTCTCAATGATTTATTTGGAGGA
CCACCTTTGAGTGAGAAGATAGCTCCTTTGCCTTCACTTATGGAAGGCGAAGACAGCTTGTACAAGGAGTTTACATGGTTTTGA
Edits in Original Sequence 
(5')GTTCAGCTTAGTCAAGAACTCGtGTAAAGCTACCACATTATTCCCTGGGATTCCATTGATAGACCTCTCAAAACCGGACTCCAAGC
ACCTTCTTGTGAAGGCGTGCGAAGAATTTGGATTCTGTAAAGTCATCAATCATGGTGTTCCCACTGAATTCATATCCAAACTTGAGTCTG
AAGCCATCAAGTTCTTCTCTTTGCCCCTCTCTGAGAAGGAAAAAGCGGGGCCCCCTGACCCTTTCGGCTATGGTAACAAGATGATTGGGC
CAAATGGCGACGTGGGTTGGGTTGAATACATCCTCTTAACGACCAACCCTGGATTCAATTACCAAAAGTTCGAATCAGTTTTTGGCGTCA
CCCCAGAGAAGTTTCAGGGTGCTGTAAATGATTATATATCGGCAGTGAAGAACATGGCCTGTTCAATTCTCGAACAATTGGCTGAAGGGT
TGAATATTCAGCCACAGACTGTGTTCAGCAAGCTGTTGATGGATGAACAGAGTGACTCTGTTTTCAGGCTAAATCACTACCCACCCTGCC
CTGACCTTCAAGAACTGCATGGCAGGAATTTAATTGGATTTGGAGAACACACTGACCCACAAATCATATCTGTTTTGCGATCCAACAACA
CTTCTGGCCTTCAAATCGCATTGAAGGATGGAAGTTGGATTTCAGTTCCACCTGATCAAAATTCTTTCTTTATCAACGTTGGTGACTCAA
TGCAGGTTTTGACAAATGGGAGGTTTAAAAGTGTGAGGCATAGAGXTATTGGCCAACAGTTCCAAATCAAGGGTCTCAATGATTTATTTc
GGAGGACCACCTTTGAGTGAGAAGATAGCTCCTTTGCCTTCACTTATGGAAGGCGAAGACAGCTTGTACAAGGAGTTTACATGGTTTTGA
(3')GTACAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan