ESTScan Details for Unigene SGN-U301083

Score 
259
Direction 
Reverse
Predicted Peptide Sequence 
PNPHTIGEAVMAQKHPKYYWLLIRANTIAFVSSXEHNYFAHSWVEHLQQVLDAAVGLRHVAAIAAIAITYAIALVTVAPKGARGRQLGNT
SDILVILLMVWSGWMVTTLYEINALFKKWLKIRRMDSRGYSFSDFGSQLLSRLSLRAPRSSGGVTPCTPATPLPDLWFSVSGEI
Predicted Coding Sequence 
XXCCCAAATCCACACACAATAGGAGAAGCTGTTATGGCACAAAAGCATCCAAAATATTACTGGCTTCTGATTCGGGCAAACACAATAGCA
TTTGTTTCATCTXCTGAGCACAATTATTTTGCTCATTCGTGGGTCGAGCATCTCCAGCAAGTACTTGATGCCGCTGTTGGCCTTCGTCAT
GTGGCTGCCATTGCAGCCATAGCCATAACTTATGCTATAGCACTTGTCACAGTAGCACCAAAAGGAGCAAGAGGGCGGCAATTGGGTAAT
ACAAGTGATATTCTAGTCATCCTACTCATGGTCTGGAGCGGTTGGATGGTCACAACCCTGTATGAGATAAACGCTCTGTTCAAGAAATGG
CTGAAAATTCGTCGGATGGACAGCAGAGGCTACTCGTTTTCTGATTTTGGCAGTCAGTTGCTCTCTCGGCTCAGCCTGCGGGCACCTAGG
TCCAGTGGCGGAGTTACTCCATGTACCCCAGCTACCCCACTTCCTGACTTGTGGTTTTCCGTTTCTGGTGAAATTTAA
Edits in Original Sequence 
(5')XXCCCAAATCCACACACAATAGGAGAAGCTGTTATGGCACAAAAGCATCCAAAATATTACTGGCTTCTGATTCGGGCAAACACAAT
AGCATTTGTTTCATCTXCTGAGCACAATTATTTTGCTCATTCGTGGGTCGAGCATCTCCAGCAAGTACTTGATGCCGCTGTTGGCCTTCG
TCATGTGGCTaGCCATTGCAGCCATAGCCATAACTTATGCTATAGCACTTGTCACAGTAGCACCAAAAGGAGCAAGAGGGCGGCAATTGG
GTAATACAAGTGATATTCTAGTCATCCTACTCATGGTCTGGAGCGGTTGGATGGTCACAACCCTGTATGAGATAAACGCTCTGTTCAAGA
AATGGCTGAAAATTCGTCGGATGGACAGCAGAGGCTACTCGTTTTCTGATTTTGGCAGTCAGTTGCTCTCTCGGCTCAGCCTGCGGGCAC
CTAGGTCCAGTGGCGGAGTTACTCCATGTACCCCAGCTACCCCACTTCCtTGACTTGTGGTTTTCCGTTTCTGGTGAAATTTAA(3')CG
ATTAATTGTGGAAATTAATGATTTAATATTCATTCGTACAATTAGTAGTGCTGGTGCTTAAGGCATACTCTAACGTATGTGCAGTTAATA
AAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan