Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U301237

Score 
367
Direction 
Forward
Predicted Peptide Sequence 
APGNIRDGKGATPLHLAARQRRPECVHALLDSGALVCASTGGYGFPGSTPLHLAARGGSLDCVRELLAWGADRLNRDASGRIPYTVALRH
NHGACAALLNPSSAEPLVWPSPLKLISELNQEAKVLLERALMEANREREKSILKGTSFSVASPSHSDTGTDDNVSEISDTELAGYALIKF
AQLRSNPADTRCVLNAHWPCVAXNKPNPMTATVAIPACPFCRSSIVQLIVAKVFSENSIELDVNSPKLRKSRRSWNLNEGSSSFKGLGAV
GSISKIVGRGSGRITIENEWIDKPVGLDXMIKLGINIQESKKSHLVKKDRNDGVPHPHW
Predicted Coding Sequence 
GCACCAGGGAATATTAGAGATGGTAAAGGAGCAACACCATTGCACTTGGCCGCTCGTCAAAGACGGCCTGAATGTGTTCATGCATTGCTG
GACAGTGGAGCTCTAGTTTGTGCTTCAACGGGTGGATATGGCTTTCCAGGGAGCACTCCGCTTCACTTGGCAGCAAGAGGAGGTTCTCTT
GATTGCGTTCGCGAACTCTTAGCCTGGGGCGCAGATCGACTTAACAGAGATGCATCTGGGAGAATACCGTATACGGTTGCTCTGAGGCAT
AATCATGGAGCTTGTGCGGCGTTACTGAATCCATCATCTGCTGAGCCTCTTGTCTGGCCATCACCTTTAAAGTTGATTAGTGAGCTTAAT
CAGGAGGCCAAAGTTCTGTTGGAACGTGCATTGATGGAGGCAAACAGGGAAAGAGAAAAGAGCATTCTAAAGGGCACTTCATTCTCTGTA
GCTTCTCCATCTCATTCTGATACAGGAACTGATGATAACGTATCTGAGATTAGTGACACGGAGCTTGCGGGATATGCTTTGATCAAGTTT
GCACAATTGAGGTCCAACCCTGCGGACACCAGATGTGTGCTCAATGCACATTGGCCTTGTGTTGCCATXAACAAACCCAACCCAATGACT
GCAACCGTTGCAATACCAGCCTGCCCGTTCTGCCGAAGCAGCATTGTCCAATTGATTGTTGCAAAGGTTTTTTCCGAGAACAGCATTGAA
CTCGATGTCAACTCTCCGAAGCTGAGAAAGTCTAGGAGGTCTTGGAACCTCAATGAAGGCAGCAGCAGTTTCAAAGGCTTAGGAGCAGTA
GGGTCAATAAGTAAAATTGTTGGACGGGGTTCAGGCAGGATCACCATTGAGAATGAATGGATTGATAAGCCAGTAGGTCTTGATXACATG
ATAAAGCTTGGTATCAACATTCAAGAATCAAAGAAGTCCCACTTGGTGAAAAAGGATCGAAACGATGGXGTCCCGCATCCACATTGG
Edits in Original Sequence 
(5')GCACCAGGGAATATTAGAGATGGTAAAGGAGCAACACCATTGCACTTGGCCGCTCGTCAAAGACGGCCTGAATGTGTTCATGCATT
GCTGGACAGTGGAGCTCTAGTTTGTGCTTCAACGGGTGGATATGGCTTTCCAGGGAGCACTCCGCTTCACTTGGCAGCAAGAGGAGGTTC
TCTTGATTGCGTTCGCGAACTCTTAGCCTGGGGCGCAGATCGACTTAACAGAGATGCATCTGGGAGAATACCGTATACGGTTGCTCTGAG
GCATAATCATGGAGCTTGTGCGGCGTTACTGAATCCATCATCTGCTGAGCCTCTTGTCTGGCCATCACCTTTAAAGTTGATTAGTGAGCT
TAATCAGGAGGCCAAAGTTCTGTTGGAACGTGCATTGATGGAGGCAAACAGGGAAAGAGAAAAGAGCATTCTAAAGGGCACTTCATTCTC
TGTAGCTTCTCCATCTCATTCTGATACAGGAACTGATGATAACGTATCTGAGATTAGTGACACGGAGCTgTGCGGGATATGCTTTGATCA
AGTTTGCACAATTGAGGTCCAACCCTGCGGACACCAGATGTGTGCTCAATGCACATTGGCCTTGTGTTGCCATXAACAAACCCAACCCAA
TGACTGCAACCGTTGCAATACCAGCCTGCCCGTTCTGCCGAAGCAGCATTGTCCAATTGATTGTTGCAAAGGTTTTTTCCGAGAACAGCA
TTGAACTCGATGTCAACTCTCCGAAGCTGAGAAAGTCTAGGAGGTCTTGGAACCTCAATGAAGGCAGCAGCAGTTTCAAAGGCTTAGGAG
CAGTAGGGTCAATAAGTAAAATTGTTGGACGGGGTTCAGGCAGGATCACCATTGAGAATGAATGGATTGATAAGCCAGTAGGTCTTGATX
ACATGATAAAGCTTGGTATCAACATTCAAGAATCAAAGAAGTCCCgACTTGGTGAAAAAGGATCGAAACGATGGXGTCCCGCATCCACAT
TGG(3')TATAGATACATAGCTCTCCATCTGCTGCGTAGAATTGGGAAATAAGCAAAGCAAAGTGGTTTTGCAGCTTTGGGTTGGTGAAT
ATATCGTTTGTGGGTCAGATTATTGTAATATTTGGTTTCACTTCGGCTTGAAGAAGGTTGTGCTTTTGGGGCCTATATTAGTGACCTGCA
TAGAAAGAATTCTTTTACCTTTCTTTTTTTTTTTTTAATTGAAATTCAACATTCTTCCACATTCTTCACTGCCTACCCACCAAGTTTAGG
TTGTAATATACAGGATCATTGGAAATAGCCCAGCAAGCGAGCAGGAGAGTTGATCCTACGTCACTCTGTCCTTTGCCATTAAAAAAAAAA
AAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan