ESTScan Details for Unigene SGN-U301372

Score 
668
Direction 
Forward
Predicted Peptide Sequence 
LQARLNRVKQNAGEKSKEKPAESQXQLVCSTFELPRILQNHDGGSLGFLLRYLVNISANLPHHFRKSYASVSALSMAKAKFQLPKQRKFS
TGHRNPSFSWMATVGENVQSNASAAAPPPTSVPVRVAHELLQAGHRYLDVRTAEEFSAGHAAGAVNVPYMFRVGSGMTKNLNFVEEVLAI
FGKDDEIIVGCQLGKRSLMAATDLISAGFTGITDIAGGYAAWVQNELPDRVVMTMEEGNTGCDAX
Predicted Coding Sequence 
CTCCAAGCTAGACTAAACAGAGTAAAACAAAACGCTGGTGAAAAGAGCAAAGAAAAACCAGCAGAGTCACAAGAXCAGCTAGTTTGTTCA
ACATTTGAACTTCCTCGTATACTTCAAAACCATGATGGGGGCTCTCTCGGTTTCCTCCTCCGCTACCTTGTCAACATTTCTGCTAATCTT
CCGCACCATTTCAGGAAAAGCTATGCATCAGTCTCAGCGCTATCAATGGCCAAGGCTAAGTTTCAACTCCCGAAACAACGCAAGTTCAGC
ACTGGCCACAGAAATCCCAGCTTCAGTTGGATGGCTACTGTTGGAGAGAATGTTCAATCAAATGCATCAGCAGCAGCACCACCACCAACA
TCAGTCCCGGTTCGTGTAGCTCACGAGCTGCTTCAGGCAGGCCATCGTTATTTAGATGTCAGGACTGCTGAAGAATTCAGTGCTGGTCAT
GCTGCTGGGGCTGTCAATGTGCCTTACATGTTTAGAGTTGGATCAGGTATGACTAAAAACCTGAACTTCGTGGAGGAAGTTTTAGCAATT
TTTGGGAAAGATGACGAAATTATTGTTGGCTGCCAATTGGGGAAAAGGTCATTGATGGCTGCAACTGATCTTATATCTGCTGGGTTTACT
GGCATTACAGACATTGCAGGTGGATATGCTGCCTGGGTACAGAATGAACTTCCXGACAGAGTCGTGATGACTATGGAGGAGGGGAACACG
GGTTGTGACGCTNAA
Edits in Original Sequence 
(5')CTCCAAGCTAGACTAAACAGAGTAAAACAAAACGCTGGTGAAAAGAGCAAAGAAAAACCAGCAGAGTCACAAGAXCAGCTAGTTTG
TTCAACATTTGAACTTCCTCGTATACTTCAAAACCATGATGGGGGCTCTCTCGGTTTCCTCCTCCGCTACCTTGTCAACATTTCTGCgTA
ATCTTCCGCACCATTTCAGGAAAAGCTATGCATCAGTCTCAGCGCTATCAATGGCCAAGGCTAAGTTTCAACTCCCGAAACAACGCAAGT
TCAGCACTGGCCACAGAAATCCCAGCTTCAGTTGGATGGCTACTGTTGGAGAGAATGTTCAATCAAATGCATCAGCAGCAGCACCACCAC
CAACATCAGTCCCGGTTCGTGTAGCTCACGAGCTGCTTCAGGCAGGCCATCGTTATTTAGATGTCAGGACTGCTGAAGAATTCAGTGCTG
GTCATGCTGCTGGGGCTGTCAATGTGCCTTACATGTTTAGAGTTGGATCAGGTATGACTAAAAACCTGAACTTCGTGGAGGAAGTTTTAG
CAATTTTTGGGAAAGATGACGAAATTATTGTTGGCTGCCAATTGGGGAAAAGGTCATTGATGGCTGCAACTGATCTTATATCTGCTGGGT
TTACTGGCATTACAGACATTGCAGGTGGATATGCTGCCTGGGTACAGAATGAACTTCCXGACAGAGTCGTGATGACTATGGAGGAGGGGA
ACACGGGTTGTGACGCTNAA(3')TAACACAGGCTATGTACAGCGTTAGATTNATGCAAATAATTTTTTTAAAAATAAAAATA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan