ESTScan Details for Unigene SGN-U301431

Score 
355
Direction 
Forward
Predicted Peptide Sequence 
KVRIGVPKVSNTSRKKRKMASSKGIGIGGGAGGPKTTAPVTTELDKLSMEQLRAVKEQADLEVNLLQDSLSNIRTATARLDIASNALNDL
SXPAPREENAGAFDGILYVPGTLDDADKVLVDVGTGYFIEKTMVEGKDYCERKINLLKSNYDQLLETFYSGYYCSKMSQDTDPVTTGGKR
VSPGKGGYKKKSIADEVGIXLTGQVEATRAITMEIIDFCNIQYQTVIINLYVDLLTS
Predicted Coding Sequence 
XXCAAAGTCAGAATTGGGGTACCAAAGGTCAGCAATACCAGCAGAAAGAAAAGGAAAATGGCGTCGTCGAAGGGGATCGGAATCGGAGGA
GGCGCCGGCGGGCCAAAAACCACCGCACCGGTGACGACGGAGTTAGATAAGTTAAGCATGGAGCAGTTAAGAGCCGTAAAAGAACAGGCC
GATCTCGAAGTCAATCTTCTCCAAGACAGCCTTAGCAACATCCGCACTGCCACTGCTCGTCTCGACATCGCCTCAAATGCTCTGAATGAC
CTCTCCXCTCCGGCCCCAAGGGAAGAAAATGCTGGTGCCTTTGACGGCATCCTTTATGTTCCGGGAACACTGGATGATGCTGACAAGGTG
CTTGTGGACGTTGGCACTGGATATTTCATTGAGAAAACAATGGTGGAAGGAAAAGATTATTGTGAGCGAAAGATTAACTTGCTAAAGTCC
AACTATGATCAGCTTCTTGAGACATTTTACTCTGGCTACTACTGCAGCAAAATGTCTCAGGATACTGATCCTGTTACGACTGGGGGAAAA
AGAGTGTCCCCAGGCAAAGGTGGCTACAAGAAGAAAAGTATAGCTGATGAGGTTGGAATTGXTCTTACAGGCCAAGTTGAGGCAACTCGC
GCCATCACAATGGAAATTATCGACTTTTGTAATATCCAGTATCAGACTGTCATCATAAACCTTTATGTTGACTTGCTAACTTCATAA
Edits in Original Sequence 
(5')XXCAAAGTCAGAATTGGGGTACCAAAGGTCAGCAATACCAGCAGAAAGAAAAGGAAAATGGCGTCGTCGAAGGGGATCGGAATCGG
AGGAGGCGCCGGCGGGCCAAAAACCACCGCACCGGTGACGACGGAGTTAGATAAGTTAAGCATGGAGCAGTTAAGAGCCGTAAAAGAACA
GGCCGATCTCGAAGTCAATCTTCTCCAAGACAGCCTTAGCAACATCCGCACTGCCACTGCTCGTCTCGACATCGCCTCAAATGCTCTGAA
TGACCTCTCCXCTCCGGCCCCAAGGGAAGAAAATGCTGGTGCCTTTGACGGCATCgCTTTATGTTCCGGGAACACTGGATGATGCTGACA
AGGTGCTTGTGGACGTTGGCACTGGATATTTCATTGAGAAAACAATGGTGGAAGGAAAAGATTATTGTGAGCGAAAGATTAACTTGCTAA
AGTCCAACTATGATCAGCTTCTTGAGACATTTTACTCgTGGCTACTACTGCAGCAAAATaGTCTCAGGATACTGATCCTGTTACGACTGG
GGGAAAAAGAGTGTCCCCAGGCAAAGGTGGCTACtAAGAAGAAAAGTATAGCTGATGAGGTTGGAATTGXTCTTACAGGCCAAGTTGAGG
CAACTCGCGCCATCACAATaGGAAATTATCGACTTTTGTAATATCCAGTATCAGACTGTgCATCATAAACCTTTATGTTGACTTGCTAAC
TTCATAA(3')ACTAGTTTAGGTTTTCCTTGTTCAATTGGCGGAATGGGCTTGTGCAGAGTTAGTTGAAAAGCATATCTTAGTGCAGGTC
ATTGTTGAGATTGAAGTGAGTGGAGTTAAAAGCTGACATTTTAGCGGAACATAAAAAATATCTAAAGTTTATTGTATTAACTTTAATATT
AGTGTTATTACTGCTATTCTTTTGGGTGTTTTCAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan