ESTScan Details for Unigene SGN-U301464

Score 
726
Direction 
Forward
Predicted Peptide Sequence 
PLFIDLQSGSHTYLRAFSSAPVITVAVERGWSEAASPNVRGPPALVFNFSQLDEKLKAGYKATTSGKFTEALKLFRSILHTIPLIVVETR
REVDEVKELIVIAKEYVLGLQMELKRRELKEDPVRQQELAAYFTHCNLQLPHSRLALLNAMLVCYKAGNLSTAANFARRLLDTNPTNENQ
ARNARQVLQAAERNMKDVSQLNYDFRNPFVPVEPRMFPYTVDRRMSSALIAVPILSITAGAIITVCDLAVVGADASGLLALLHKCDDYNS
FEYLVHPNWLVVRNIKINIFSHCCCEGRVSSRDFVGKAGRELFRTSVXVLLNDXRLSIKQGQGALLYWPV
Predicted Coding Sequence 
XAGCCATTGTTTATTGATCTTCAGTCAGGCAGTCATACTTATCTGCGTGCCTTCTCCTCTGCACCAGTGATTACTGTTGCAGTTGAACGG
GGTTGGAGTGAGGCAGCAAGTCCTAATGTGCGGGGTCCACCTGCCCTTGTGTTCAACTTTTCTCAGCTGGATGAGAAACTGAAGGCTGGC
TACAAGGCCACAACTTCTGGAAAGTTCACTGAAGCACTGAAACTATTTCGGTCTATTCTGCATACAATTCCCCTTATTGTAGTTGAGACT
CGGAGAGAAGTGGATGAAGTTAAGGAATTGATTGTTATTGCAAAGGAGTATGTTCTAGGTTTGCAAATGGAGCTAAAAAGGAGGGAATTG
AAGGAGGATCCTGTTCGTCAGCAGGAGCTAGCTGCCTACTTCACTCATTGCAATCTGCAGCTCCCCCATTCTAGACTTGCCCTATTGAAT
GCCATGCTTGTTTGCTACAAGGCTGGCAACCTCAGCACTGCAGCAAACTTTGCTAGGCGCCTCTTGGACACCAATCCAACAAATGAAAAC
CAGGCCAGGAATGCTCGTCAAGTTCTTCAGGCTGCAGAGAGAAACATGAAAGATGTTTCTCAGCTGAATTATGACTTCAGAAACCCCTTT
GTGCCTGTGGAGCCACGTATGTTCCCATATACCGTGGACAGAAGGATGTCATCTGCCCTTATTGCGGTACCCATTTTGTCCATCACAGCA
GGGGCAATTATTACTGTGTGTGATCTTGCTGTTGTTGGAGCTGATGCATCTGGCCTTCTTGCTCTCCTTCACAAATGCGATGATTACAAT
TCCTTTGAATATTTAGTTCATCCCAACTGGCTTGTCGTTAGAAACATAAAGATAAATATTTTTTCTCACTGTTGCTGTGAAGGAAGGGTT
TCATCCAGAGACTTTGTAGGGAAAGCTGGAAGAGAGCTATTTAGAACCTCTGTTXTTGTTTTGTTGAATGATGXTCGTCTCTCCATCAAA
CAAGGTCAGGGAGCTCTACTCTATTGGCCGGTCTGA
Edits in Original Sequence 
(5')XAGCCATTGTTTATTGATCTTCAGTCAGGCAGTCATACTTATCTGCGTGCCTTCTCCTCTGCACCAGTGATTACTGTTGCAGTTGA
ACGGGGTTGGAGTGAGGCAGCAAGTCCTAATGTGCGGGGTCCACCTGCCCTTGTGTTCAACTTTTCTCAGCTGGATGAGAAACTGAAGGC
TGGCTACAAGGCCACAACTTCTGGAAAGTTCACTGAAGCACTGAAACTATTTCGGTCTATTCTGCATACAATTCCCCTTATTGTAGTTGA
GACTCGGAGAGAAGTGGATGAAGTTAAGGAATTGATTGTTATTGCAAAGGAGTATGTTCTAGGTTTGCAAATGGAGCTAAAAAGGAGGGA
ATTGAAGGAGGATCCTGTTCGTCAGCAGGAGCTAGCTGCCTACTTCACTCATTGCAATCTGCAGCTCCCCCATTCTAGACTTGCCCTATT
GAATGCCATGCTTGTTTGCTACAAGGCTGGCAACCTCAGCACTGCAGCAAACTTTGCTAGGCGCCTCTTGGACACCAATCCAACAAATGA
AAACCAGGCCAGGAATGCTCGTCAAGTTCTTCAGGCTGCAGAGAGAAACATGAAAGATGTTTCTCAGCTGAATTATGACTTCAGAAACCC
CTTTGTGaCCTGTGGAGCCACGTATGTTCCCATATACCGTGGACAGAAGGATGTCATCTGCCCTTATTGCGGTACCCATTTTGtTCCATC
ACAGCAGGGGCAATTATgTACTGTGTGTGATCTTGCTGTTGTTGGAGCTGATGCATCTGGCCTTCtTTGCTCTCCTTCACAAATGCGATG
ATTACAATTCCTTTGAATATTTAGTTCATCCCAACTGGCTgTGTCGTTAGAAACATAAAGATAAATATTTTTTCTCACTGTTGCTGTGAA
GGAAGGGTTTCATCCAGAGACTTTGTAGGGAAAGCTGGAAGAGAGCTATTTAGAACCTCTGTTXTTGTTTTGTTGAATGATGXTCGTCTC
TCCATCAAACAAGGTCAGGGAGCTCTACTCTATTGGCCGGTCTGA(3')TTTTGTTCTTTTTCCCTTTCTGCGGTGTGGCTGGCTATGAA
TAATGTAATGGAATTTGATACTATCTTTTTGTATTACTCCGTATTTGACTAGTTTTTTTCCCCCTTCTTACCGATAGTGTTATCCTTCTG
TACAAGTTTTCATTCTTTTTGCTATATCTACTGAACTCAATGATATCTTAATGGGATTCAGTATTTAGAACTCTCTGAAGGGAATTTACT
GCAGTAAGAGCAATTGGTAGTTAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan