ESTScan Details for Unigene SGN-U301488

Score 
415
Direction 
Forward
Predicted Peptide Sequence 
MSSQLIENHRENAEMYSDPALCKEKSRXAPAEYEPPKGPTALDELIEAGYNESTGFVWLKQKNKKEHKFRSIGRTVAYDTEVTAFVEDRR
MKKLTGVKSKELFIWVTVSDIYIEDPNSEKVTFKNPAGFSKTFPTKAFEDGEVDEEN
Predicted Coding Sequence 
ATGTCATCCCAACTCATTGAAAACCATAGAGAAAATGCTGAAATGTACTCAGACCCTGCCCTCTGCAAAGAAAAATCTCGTGXAGCTCCT
GCAGAATATGAACCTCCCAAAGGGCCTACTGCCCTTGATGAGCTCATCGAGGCGGGCTATAATGAATCTACAGGTTTCGTTTGGCTGAAG
CAGAAGAACAAAAAGGAGCATAAGTTTCGATCCATTGGCCGTACTGTAGCGTATGATACAGAGGTTACTGCCTTTGTAGAGGATCGTAGG
ATGAAAAAGCTGACGGGTGTAAAAAGCAAGGAACTCTTTATTTGGGTCACTGTTTCTGATATTTACATTGAAGATCCAAATTCTGAGAAA
GTTACGTTCAAGAATCCGGCTGGTTTTTCGAAGACTTTTCCAACTAAGGCCTTTGAGGATGGAGAAGTGGATGAAGAGAACTGA
Edits in Original Sequence 
ACCTCATACAATCAATCTCCTTCTGCCTTCCCATTTCCATTCCAAAGTCCCTCATCCTAAAAAA(5')ATGTCATCCCAACTCATTGAAA
ACCATAGAGAAAATGCTGAAATGTACTCAGACCCTGCCCTCTGCAAAGAAAAATCTCGTGXAGCTCCTGCAGAATATGAACCTCCCAAAG
GGCCTACTGCCCTTgGATGAGCTCATCGAGGCGGGCTATAATGAATCTACAGGTTTCGTTTGGCTGAAGCAGAAGAACAAAAAGGAGCAT
AAGTTTCGATCCATTGGCCGTACTGTAGCGTATGATACAGAGGTTACTGCCTTTGTAGAGGATCGTAGGATGAAAAAGCTGACGGGTGTA
AAAAGCAAGGAACTCTTTATTTGGGTCACTGTTTCTGATATTTACATTGAAGATCCAAATTCTGAGAAAGTTACGTTCAAGAATCCGGCT
GGTTTTTCGAAGACTTTTCCAACTAAGGCCTTTGAGGATGGAGAAGTGGATGAAGAGAACTGA(3')AAGGTCTAGGCAGAATTAGGACA
TGCTTGTCGGAAGGAGGGGAAAATATGAATAATGTTTAGGAGTACTTCATAATGGTAAAAGAGTGGATTATTGTAAGTTTTATGTTGCTG
ATGAAGTGATAGATATTGTAGCAAATCTTCTTGTGCAATGATTTGCTCAAGTTAATTAAGAAAATTATATGTTATTTTGTTGGTAAAAAA
AAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan