ESTScan Details for Unigene SGN-U301533

Score 
377
Direction 
Forward
Predicted Peptide Sequence 
LASTESQFPTLDVYSFGPKLPTALPTQSTPPSSNNNPEKEKKGGGDLRRSQDRTGQDRLGEAKXLAYHSEIKTXGEAMGQIKVEVVHGKR
LVIRDFKSSDPYVLLKLGNQTAKTKVINSCLNPVWNEEFSFTFSEPVGVLKLEVFDKDRFKSDDKMGHAELSLQPLVAAARLKQILSVAT
DGMTLRKVIPESDNCLATESSIVWANGEVRQDVWLRLCDVESGEVELKIKLVNLPAVSPEGSGGANVXAQVFDNPLMCTEADVTVENLRX
LTYSSYPWSNEDFKVVSIVVMEIVGLSCYSLTVKHNSGFL
Predicted Coding Sequence 
CTCGCGTCAACAGAATCCCAATTCCCCACCTTGGATGTATATAGCTTTGGCCCAAAACTTCCGACGGCXCTGCCTACACAGTCGACACCT
CCAAGCTCCAACAACAACCCAGAAAAGGAAAAAAAAGGGGGXGGAGATTTAAGGAGATCACAGGACAGGACAGGACAGGACAGACTTGGT
GAGGCTAAAXCTCTAGCCTACCACTCTGAAATCAAAACACXGGGAGAAGCAATGGGGCAGATTAAAGTAGAGGTAGTACACGGGAAAAGA
CTGGTGATCAGGGATTTCAAGAGCAGTGATCCTTATGTCCTTCTCAAGCTTGGAAATCAGACAGCAAAAACCAAAGTTATAAACAGCTGT
CTCAATCCCGTTTGGAATGAAGAGTTTAGTTTCACCTTCTCTGAACCTGTTGGAGTTCTCAAGCTGGAAGTGTTCGATAAAGATCGGTTC
AAGTCTGATGACAAGATGGGACATGCTGAGCTTAGCCTTCAACCCTTAGTTGCTGCAGCGAGGCTGAAGCAGATACTTAGCGTTGCCACT
GATGGGATGACCTTGAGAAAGGTTATCCCTGAGAGCGATAACTGTCTGGCCACTGAAAGCTCCATTGTTTGGGCAAATGGTGAGGTGAGG
CAAGATGTTTGGCTGAGGCTGTGTGATGTGGAATCTGGTGAAGTAGAGTTGAAGATCAAGCTAGTGAATCTTCCTGCAGTTTCCCCAGAA
GGTAGTGGGGGAGCAAATGTTCXGGCACAAGTGTTTGATAATCCGTTAATGTGCACAGAAGCTGATGTGACAGTTGAGAATCTCAGAGXT
CTAACCTATTCCAGCTATCCTTGGAGTAACGAAGATTTCAAAGTAGTTTCAATTGTAGTTATGGAGATAGTGGGTCTAAGTTGCTATTCA
CTCACTGTCAAACATAATAGTGGTTTTCTCTAG
Edits in Original Sequence 
(5')CTCGCGTCAACAGAATCCCAtATTCCCCACCTTGGATGTATATAGCTTTGGCCCAAAACTTCCGACGGCXCTGCCTACACAGTCGA
CACCTCCAAGCTCCAACAACAACCCAGAAAAGGAAAAAAAAGGGGGXGGAGATTTAAGGAGATCACAGGACAGGACAGGACAGGACAGAC
TTGGTGAGGCTAAAXCTCTAGCCTACCACTCTGAAATCAAAACACXGGGAGAAGCAATGGGGCAGATTAAAGTAGAGGTAGTACACGGGA
AAAGACTGGTGATCAGGGATTTCAAGAGCAGTGATCCTTATGTCCTTCTCAAGCTTGGAAATCAGACAGCAAAAACCAAAGTTATAAACA
GCTGTCTCAATCCCGTTTGGAATGAAGAGTTTAGTTTCACCTTCTCTGAACCTGTTGGAGTTCTCAAGCTGGAAGTGTTCGATAAAGATC
GGTTCAAGTCTGATGACAAGATGGGACATGCTGAGCTTAGCCTTCAACCCTTAGTTGCTGCAGCGAGGCTGAAGCAGATACTTAGCGTTG
CCACTGATGGGATGACCTTGAGAAAGGTTATCCCTGAGAGCGATAACTGTCTGGCCACTGAAAGCTCCATTGTTTGGGCAAATGGTGAGG
TGAGGCAAGATGTTTGGCTGAGGCTGTGTGATGTGGAATCTGGTGAAGTAGAGTTGAAGATCAAGCTAGTGAATCTTCCTGCAGTTTCCC
CAGcAAGGTAGTGGGGGAGCAAATGTTCXGGCACAAGTGTTTGATAATCCGTTAATGTGCACAGAAGCTGATGTcGACAGTTGAGAATCT
CAGAGXTCTAACCTATTCCAGCTATCCTTGGAGTAACGAAGATTTCAAAGTAGTTTCAATTGTAGTTATGGAGATAGTGGGTCTAAGTTG
CTATTCACTCACTGTCAAACATAATAGTGGTTTTCTCTAG(3')CATAAGATGTTAAAGAGGGTTGTATGTGAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan