ESTScan Details for Unigene SGN-U301615

Score 
258
Direction 
Forward
Predicted Peptide Sequence 
ARKLHALVEFENSESAERAVEKLNDQKNWRKGLRXQVLAKTIAKVRPEEQEAEFDGLLDDDETPPGSSIVSPELSPRPIISDSPPENNGY
ESSGASKTKAWNKGRGKPRHRLTSSHSGRGLLSLSPQSNNGIFILGEAPLTRQNAKGPKMPEEPGVLPWAGGSRSVSLFPSRLVKLGVID
AFSTQFCSITTLS
Predicted Coding Sequence 
GCTCGAAAGCTTCATGCGTTAGTAGAGTTCGAGAATAGTGAATCAGCTGAGAGAGCGGTTGAAAAACTCAATGACCAAAAGAATTGGAGA
AAAGGCCTACGCGXTCAGGTGCTTGCTAAGACGATCGCCAAAGTCCGTCCTGAAGAGCAAGAAGCAGAGTTTGATGGTCTTTTAGATGAT
GATGAGACACCTCCAGGATCCAGCATAGTATCACCTGAACTATCTCCTCGCCCAATTATCTCGGATTCACCTCCAGAAAATAACGGTTAT
GAAAGTTCAGGCGCATCAAAGACGAAAGCATGGAACAAAGGGCGTGGCAAACCTCGACACCGTCTTACCAGTAGTCACAGTGGGCGCGGC
TTGCTCTCCTTGTCACCACAGTCGAATAACGGCATCTTCATCCTTGGAGAGGCACCATTGACAAGGCAAAATGCAAAGGGTCCTAAAATG
CCAGAGGAACCAGGGGTTTTACCATGGGCAGGGGGAAGCCGATCAGTGTCTCTGTTCCCATCCAGACTTGTCAAGCTTGGTGTAATTGAT
GCTTTTTCTACCCAATTTTGCAGCATTACCACTCTTAGCTAA
Edits in Original Sequence 
(5')GCTCGAAAGCTTCATGCGTTAGTAGAGTTCGAGAATAGTGAATCAGCTGAGAGAGCGGTTGAAAAACTCAATGACCAAAAGAATTG
GAGAAAAGGCCTACGCGXTCAGGTGCTTGCTAAGACGATCGCCAAAGTCCGTCCTGAAGAGCAAGAAGtCAGAGTTTGATGGTCTTTTAG
ATGATGATGAGACACCTCCAGGATCCAGCATAGTATCACCTGAACTATCTCCTCGCCCAATTATCTCGGATTCACCTCCAGAAAATAACG
GTTATGAAAGTTCAGGCGCATCAAAGACGAAAGCATGGAACAAAGGGCGTGGCAAACCTCGACACCGTCTTACCAGTAGTCACAGTGGGC
GCGGCTTGCTCTCCTTGTCACCACAGTCGAATAACGGCATCTTCATCCTTGGAGAGGCACCATTGACAAGGCAAAATGCAAAGGGTCCTA
AAATGCCAGAcGGAACCAGGGGTTTTACCATGGGCAGGGGGAAGCCGATCAGTGTCTCTGTTCCCATCCAGACTTGTCAAGCTgTGGTGT
AATTGATGCTTTTTCTACCCAATTTTGCAGCATTACCACTCTTAGCTAA(3')GTGTACAAAAGTTTGGCAAAAATTTTTTTTTTTTTTT
GGCTGGAGAGCTAAGGAAAATATAGTCAATCAACAATTGTACAAGGACTGTTCAGCCATCTACCAATAAGCACAGCTGCACAAATACATC
AGGGCATGCGAAAATCAAGATGATTACCAAGCTGCCCCAAGGCTTTATTTATCTCAGCTTTCCCTTGGTTTGGGAAATATGTGTCTTAAA
AAAATGATATTCCCTCCCCCTCAAAAATTTAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan