ESTScan Details for Unigene SGN-U301699

Score 
413
Direction 
Forward
Predicted Peptide Sequence 
MANPKVFFDITAGGSPVGRIVMELRADVVPKTAENFRALCTGEKGIGKSGKPLHFKGSTFHRVITNFMCQGGDFTRGNGTGGESIYGEKF
ADEKFALKHTGPGILSMANAGPNTNGSQFFLCTVKTEWLDGKHVVFGHVTEGMDVVKKVESYGSQSGKTSKPIVIQNSGXAVNVLARFEL
LLLSVTSEWDNTVLKLFVAFRLRHVFCIX
Predicted Coding Sequence 
ATGGCCAACCCAAAGGTTTTCTTCGACATCACCGCCGGCGGAAGCCCAGTGGGACGTATTGTCATGGAGCTCAGAGCCGACGTGGTCCCC
AAGACTGCAGAGAACTTCCGCGCCCTTTGCACAGGTGAGAAGGGCATTGGCAAATCTGGAAAGCCTCTGCACTTCAAGGGCTCAACCTTC
CACAGAGTCATCACCAACTTCATGTGCCAAGGAGGTGACTTCACACGTGGAAATGGAACTGGAGGAGAGTCTATCTACGGCGAGAAGTTT
GCTGATGAGAAGTTTGCATTGAAGCACACAGGCCCAGGAATCCTCTCGATGGCAAATGCCGGTCCAAACACAAACGGATCGCAATTCTTC
CTGTGTACAGTCAAGACCGAATGGCTGGACGGAAAACACGTGGTGTTTGGACATGTCACAGAGGGCATGGATGTCGTGAAGAAGGTAGAG
AGCTACGGCTCACAGAGCGGCAAAACATCCAAGCCAATTGTCATCCAGAACAGCGGAXCAGCTGTAAATGTTCTTGCCAGATTTGAGTTG
CTTCTGCTCAGTGTGACAAGTGAATGGGACAACACTGTGTTGAAGTTGTTTGTAGCCTTTAGACTTCGTCACGTTTTCTGCATACXX
Edits in Original Sequence 
TATACTTGTATCTTTTCTTAGTCCTCATATACAGAGTATTCGCAGCGTATTATAAGCATCGATC(5')ATGGCCAACCCAAAGGTTTTCT
TCGACATCACCGCCGGCGGAAGCCCAGTGGGACGTATTGTCATGGAGCTCAGAGCCGACGTGGTCCCCAAGACTGCAGAGAACTTCCGCG
CCCTTTGCACAGGTGAGAAGGGCATTGGCAAATCTGGAAAGCCTCTGCACTTCAAGGGCTCAACCTTCCACAGAGTCATCACCAACTTCA
TGTGCCAAGGAGGTGACTTCACACGTGGAAATGGAACTGGAGGAGAGTCTATCTACGGCGAGAAGTTTGCTGATGAGAAGTTTGCATTGA
AGCACACAGGCCCAGGAATCCTCTCGATGGCAAATGCCGGTCCAAACACAAACGGATCGCAATTCTTCCTGTGTACAGTCAAGACCGAAT
GGCTGGACGGAAAACACGTGGTGTTTGGACATGTCACAGAGGGCATGGATGTCGTGAAGAAGGTAGAGAGCTACGGCTCACAGAGCGGCA
AAACATCCAAGCCAATTGTCATCCAGAACAGCGGAXCAGCTGTAAATGTaTCTTGCCAGATTTGAGTTGCTTCTGCTCAGTGTGACAAGT
GAATGGGACAACACTGTGTTGAAGTTGTTTGTAGCCTTTAGACTTCGTCACGTTTTCTGCATACXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan