ESTScan Details for Unigene SGN-U301720

Score 
193
Direction 
Reverse
Predicted Peptide Sequence 
KQTPVKTHIIYLADEEEEGSSSSDFISESLVTNXINHLKLHFHDPRHLHSNKAQFAIFCPTIFELVSTSYFLQHFYHSSHRRTIYRKGTG
AEETYIEDFTYLFLEPRIQFCVNYMINALLVQSGAHPLNQILLTNSGSTGSLPVINSSXNHTKAVYITLLIHPQGICILVSNXTTPENEL
GPTVRIPLFLIGTTNYRTSKPMEFLNLEIRYRNVWCDITARSCNDRHRLGALP
Predicted Coding Sequence 
XGGAAACAAACACCTGTAAAAACTCACATCATATATTTAGCTGATGAAGAGGAGGAAGGTTCTTCTTCTTCTGATTTCATTTCTGAGTCT
CTTGTAACAAATGXTATAAACCACCTCAAGCTACACTTCCATGATCCGAGGCATCTTCATAGTAATAAGGCTCAATTTGCCATCTTTTGT
CCTACCATTTTTGAGTTGGTTTCCACCTCCTACTTCTTGCAACATTTTTACCACTCGTCTCATCGAAGGACGATTTATAGGAAGGGGACT
GGTGCAGAGGAGACCTACATTGAGGACTTTACATATCTCTTCCTTGAACCAAGAATCCAGTTTTGTGTCAATTACATGATCAATGCCCTT
TTGGTCCAAAGTGGTGCACACCCACTTAACCAAATCCTTCTCACCAACTCGGGATCAACTGGGAGCCTCCCTGTGATCAACTCTAGTAXT
AACCACACCAAAGCTGTATATATCACTCTTCTCATTCACCCTCAGGGTATATGCATATTAGTTTCTAATXATACAACTCCTGAAAATGAG
TTGGGGCCAACAGTCCGCATCCCTTTATTTCTCATTGGTACTACTAACTATCGTACATCAAAGCCCATGGAGTTCTTGAATTTGGAAATC
CGCTACAGAAATGTCTGGTGCGATATAACCGCAAGATCCTGCAATGACAGACATCGACTTGGTGCCCTTCCX
Edits in Original Sequence 
(5')XGGAAACAAACACCTGTAAAAACTCACATCATATATTTAGCTGATGAAGAGGAGGAAGGTTCTTCTTCTTCTGATTTCAgTTTCTG
AGTCTCTTGTAACAAATGXTATAAACCACCTCAAGCTACACTTCCATGATCCGAGGCATCTTCATAGTAATAAGGCgTCAATTTGCCATC
TTTTGTCCTACCATTTTTGAGTTGGTTTCCACCTCCTACTTCTTGCAACATTTTTACCACTCGTCTCATCGAAGGACGATTTATAGGAAG
GGGACTGGTGCAGAGGAGACCTACATTGAGGACTTTACATATCTCTTCCTTGAACCAAGAATCCAGTTTTGTGTCAATTACATGATCAAT
GCCCTTTTGGTCCAAAGTGGTGCACACCCACTTAACCAAATCCTTCTCACCAtACTCGGGATCAACTGGGAGCCTCCCTGTGATCAACTC
TAGTAXTAACCACACCAAAGCTGTATATATCACTCTTCTCATTCACCCTCAGGGTATATGCATATTAGTTTCTAATXATACAACTCCTGA
AAATGAGTTaGGGGCCAACAGTCCGCATCCCTTTATTTCTCATTGGTACTACTAACTATCGTACATCAAAGCCCATGGAGTTCTTGAATT
TGGAAATCCGCTACAGAAATGTCTGGTGCGATATAACCGCAAGATCCTGCAATGACAGACATCGACTTGGTGCCCTTCCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan