ESTScan Details for Unigene SGN-U301758

Score 
618
Direction 
Forward
Predicted Peptide Sequence 
IPRKESEVTARVSSKPYGHLSELCQSNNKGAVSPKSAMAADVVTLGDSWLSFAIKEGLIQPIQGVEEQDWFRDLTEDGRSTDGNLDPQGK
IWAVPYRWGSLVIAYKKSKFLKHKLAPVVDWADLWRPELAGKISMVDSPREIVGAVLKYMGASYNTHNITSQVAGGKSALKEKLALFAKQ
VRLFDSQYYLKAFGVGDVWVAVGWSSDILPAAKRMSNVAVVVPKSGASLWADFWAIPATSRVKTGNVGGRVRGPSPLVSQWIEFCLQSAR
ALSFX
Predicted Coding Sequence 
ATCCCAAGGAAAGAGAGTGAAGTTACAGCCAGAGTTTCGTCAAAACCTTACGGACATCTTTCTGAACTTTGCCAGTCAAATAACAAAGGA
GCTGTTAGCCCAAAATCTGCAATGGCAGCTGATGTTGTTACGCTGGGTGATTCTTGGCTCAGTTTTGCCATAAAAGAGGGTTTGATTCAG
CCCATCCAAGGGGTGGAAGAACAAGATTGGTTTCGAGATTTGACTGAGGATGGAAGGAGTACTGATGGAAATTTGGATCCTCAAGGCAAA
ATATGGGCCGTTCCGTACAGATGGGGAAGCCTGGTTATAGCTTATAAGAAAAGCAAATTTCTAAAGCATAAATTGGCTCCCGTAGTGGAT
TGGGCTGATTTATGGCGGCCTGAGCTAGCTGGGAAGATTTCAATGGTTGATTCACCACGAGAGATTGTTGGTGCAGTGTTAAAGTACATG
GGGGCTTCATATAATACACACAACATCACTTCTCAGGTTGCTGGTGGAAAATCTGCTTTGAAAGAGAAGCTTGCATTGTTTGCTAAACAG
GTTCGACTTTTTGACAGCCAGTACTATCTTAAAGCTTTCGGAGTTGGTGATGTTTGGGTGGCTGTTGGGTGGAGTAGTGATATTCTTCCT
GCTGCTAAAAGGATGTCAAATGTTGCAGTTGTTGTTCCAAAGTCTGGTGCTAGTTTATGGGCAGACTTTTGGGCGATACCTGCCACTTCC
AGAGTTAAAACAGGTAATGTTGGAGGACGAGTTAGAGGACCATCTCCTTTGGTGTCTCAATGGATTGAATTCTGTTTGCAATCTGCAAGG
GCATTATCATTTAXX
Edits in Original Sequence 
(5')ATCCCAAGGAAAGAGAGTGAAGTTACAGCCAGAGTTTCGTCAAAACCTTACGGACATCtTTTCTGAACTTTGCCAGTCAAATAACA
AAGGAGCTGTTAGCCCAAAATCTGCAATGGCAGCTGATGTTGTTACGCTGGGTGATTCTTGGCTCAGTTTTGCCATAAAAGAGGGTTTGA
TTCAGCCCATCCAAGGGGTGGAAGAACAAGATTGGTTTCGAGATTTGACTGAGGAcTGGAAGGAGTACTGATGGAAATTTGGATCCTCAA
GGCAAAATATGGGCCGTTCCGTACAGATGGGGAAGCCTGGTTATAGCTTATAAGAAAAGCAAATTTCTAAAGCATAAATTGGCTCCCGTA
GTGGATTGGGCTGATTTATGGCGGCCTGAGCTAGCTGGGAAGATTTCAATGGTTGATTCACCACGAGAGATTGTTGGTGCAGTGTTAAAG
TACATGGGGGCTTCATATAATACACACAACATCACTTCTCAGGTTGCTGGTGGAAAATCTGCTTTGAAAGAGAAGCTTGCATTGTTTGCT
AAACAGGTTCGACTTTTTGACAGCCAGTACTATCTTAAAGCTTTCGGAGTTGGTGATGTTTGGGTGGCTGTTGGGTGGAGTAGTGATATT
CTTCCTGCTGCTAAAAGGATGTCAAATGTTGCAGTTGTTGTTCCAAAGTCTGGTGCTAGTTTATGGGCAGACTTTTGGGCGATACCTGCC
ACTTCCAGAGTTAAAACAGGTAATGTTGGAGGACGAGTTAGAGGACCATCTCCTTTGGTGTCTCAATGGATTGAATTCTGTTTGCAATCT
GCAAGGGCATTATCATTTAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan