ESTScan Details for Unigene SGN-U301769

Score 
180
Direction 
Forward
Predicted Peptide Sequence 
ASPLTCLKDYPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVDYGRDIEMRAAXFVEMLVKKNSATVGSAGYQYEKSDYCLCLAIH
APRKGIVEVWQMRTGPRLLTIPCAKDDXGLQAANKARTGMQEGKKDNNKKKAVEHNGPTPMDQYSSLHPIEKKXILDLIRGLKKMKKEKN
TSSYSLNGEXLRCQAALYVHVLFLLLFRAFNPSTKQCLDRVAVVHTYKAT
Predicted Coding Sequence 
GCTTCTCCTCTTACTTGTTTGAAGGATTACCCAAGGAAGGGAGAAAAACTCACATTATCACCTAGTGGTACTCTGGCTGCAATAACTGAT
TCACTTGGTCGTATATTGCTTTTGGACACGCAGGCACTTGTTGTTGTGGACTATGGAAGGGATATCGAGATGCGAGCTGCTXTGTTTGTT
GAGATGCTTGTCAAGAAGAATTCTGCAACTGTAGGATCTGCCGGGTATCAATATGAGAAGAGTGATTATTGCCTTTGTTTAGCCATCCAT
GCACCACGTAAAGGGATAGTCGAGGTTTGGCAGATGAGAACTGGACCTCGTCTTTTAACCATTCCATGCGCCAAAGATGATXTTGGACTT
CAAGCCGCCAACAAAGCAAGAACAGGAATGCAGGAAGGAAAAAAGGATAATAATAAGAAGAAGGCAGTTGAACATAATGGTCCAACXCCG
ATGGATCAGTACAGTAGTCTTCATCCAATAGAAAAGAAAXACATACTGGATCTGATTAGGGGCCTAAAGAAAATGAAAAAGGAAAAAAAT
ACCTCATCTTATTCATTGAATGGTGAAGXTCTGAGATGTCAAGCTGCTTTATATGTACATGTACTTTTCCTGCTTTTATTCAGGGCTTTC
AATCCTTCAACGAAACAATGCCTTGACAGAGTGGCTGTCGTCCATACATACAAGGCGACATGA
Edits in Original Sequence 
(5')GCTTCTCCTCTTACTTGTTTGAAGGATTACCCAAGGAAGGGAGAAAAACTCACATTATCACCTAGTGGTACTCTGGCTGCAATAAC
TGATTCACTTGGTCGTATATTGCTTTTGGACACGCAGGCACTTGTTGTTGTGcGACTATGGAAGGGATATCGAGATGCGAGCTGCTXTGT
TTGTTGAGATGCTTGTCAAGAAGAATTCTGCAACTGTAGGATCTGCCGGGTATCAATATGAGAAGAGTGATTATTGCCTTTGTTTAGCCA
TCCATGCACCACGTAAAGGGATAGTCGAGGTTTGGCAGATGAGAACTGGACCTCGTCTTTTAACCATTCCATGCGCCAAAGATGATXTTG
GACTTCtAAGCCGCCAACAAAGCAAGAACAGGAATGCAGGAAGGAAAAAAGGATAATAATAAGAAGaAAGGCAGTTGAACATAATGGTCC
AACXCCGATGGATCAGTACAGTAGTCTTCATCCAATAGAAAAGAAAXACATACTGGATCTGATTAGGGGCCTAAAGAAAATGAAAAAGGA
AAAAAATACCTCATCTTATTCATTGAATaGGTGAAGXTCTGAGATGTCAAGCTGCTTTATATGTACATGTACTTTTCCTGCTTTTATTCA
GGGCTTTCAATCCTTCAACGAAACAATGCCTTGACAGAGTGGCTGTCGTCCATACATACAAGGCGACATGA(3')ATATTAAAGTAGAAC
TTTATTCATTCAAATTGGTGACCATTCTTAGAACCGTTTTGGATAGGTGTGAGGGTTATTAGTTTTTACTACTCGAGCACTTGGTCATAA
AAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan