ESTScan Details for Unigene SGN-U301840

Score 
200
Direction 
Forward
Predicted Peptide Sequence 
MADGGDEMELNEESDGPRRWSGGVKATGIGRGQVRSNYYGLFYLSGEVMQAIXRLMPFKAFGVASLFVGSAASATIGSLRASGIHSVDDM
KTLGANIRSGLGIDQEHKTINYGYXHGKPMAFRISLPDLALKARKHKAHH
Predicted Coding Sequence 
ATGGCGGATGGAGGAGATGAGATGGAGCTAAATGAAGAGAGTGATGGTCCTCGTCGGTGGAGCGGTGGCGTGAAGGCTACTGGTATTGGG
CGGGGGCAAGTTCGGTCCAATTATTATGGGCTATTTTATCTCTCCGGCGAGGTTATGCAGGCGATTXCTCGTTTAATGCCTTTTAAGGCC
TTCGGCGTGGCATCCCTCTTCGTTGGCTCCGCCGCTTCCGCCACCATCGGTTCTCTCCGAGCCTCTGGCATCCACTCGGTGGATGACATG
AAGACTCTAGGTGCAAATATAAGGTCTGGGCTTGGAATCGACCAAGAGCACAAGACAATTAATTATGGTTATGXTCATGGCAAACCTATG
GCATTCAGGATCTCCCTTCCTGATCTTGCCCTGAAGGCTCGCAAACACAAAGCTCATCATTGA
Edits in Original Sequence 
AGGGAA(5')ATGGCGGATGGAcGGAGATGAGATGGAGCTAAATGAAGAGAGTGATGGTCCTCGTCGGTGGAGCGGTGGCGTaGAAGGCT
ACTGGTATTGGGCGGGGGCAAGTTCGGTCCAATTATTATGGGCTATTTTATCTCTCCGGCGAGGTTATGCAGGCGATTXCTCGTTTAATG
CCTTTTAAGGCCTTCGGCGTGGCATCCCTCTTCGTTGGCTCCGCCGCTTCCGCCACCATCGGTTCTCTCCGAGCCTCTGGCATCCACTCG
GTGGATGACATGAAGACTCTAGGTGCAAATATAAGGTCTGGGCTTGGAATaCGACCAAGAGCACAAGACAATTAATTATGGTTATGXTCA
TGGCAAACCTATGGCATTCAGGATCTCCCTTCCTGATCTTGCCCTGAAGtGCTCGCAAACACAAAGCTCATCATTGA(3')ATTTTTAAT
CCTTCGTGGTAGTGGAGCTCAGAAGCAATCTCTTTTGAGAAGTACTCTCTCCTTTAGCAATATGACGATTTTGTGCATTTTTAGTGCATG
ATGACTGTTGTTTTAAAATCCCTCTGAATGGATGCTTTTGGAGGTGTACTTTTATGTGATAGTGGCCATTTTAATGTTAAAAAAAAAAAA
AAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan