ESTScan Details for Unigene SGN-U301896

Score 
332
Direction 
Forward
Predicted Peptide Sequence 
PVFANQHQRGVXATLCNIHKSKPTGAMSTPSVSEVVTMRESXTAETLTMDYHRGADVEVRIARIFNTYGPRMFLDDGRVVSNFVAQALRK
EPLTVYGDGKQTRSFQYVSDLVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQVVTYSKCGDCSTELYLNQLAFFDMFLVPFNSYQKNSRL
LEHSHGGGPFIVQGEHIVETWISNFKSGLQCPKSHIDEIQRAKEAFSVTRSFHVSSIKEIVFVWDLLA
Predicted Coding Sequence 
CCGGTTTTTGCTAACCAGCACCAGCGAGGTGTAXCGGCGACCCTCTGCAACATCCACAAGTCGAAACCTACTGGGGCAATGTCAACCCCA
TCGGTGTCCGAAGTTGTTACGATGAGGGAAAGCXGGACTGCTGAAACGTTGACAATGGACTACCACAGGGGTGCCGATGTTGAGGTGAGG
ATTGCTAGGATCTTTAATACCTATGGACCTAGAATGTTTCTTGATGATGGTCGTGTTGTCAGCAATTTTGTTGCTCAGGCCTTGAGGAAG
GAACCATTGACAGTTTATGGTGATGGGAAACAGACCAGAAGTTTCCAATACGTTTCAGATCTGGTTGAGGGTCTTATGCGCTTGATGGAA
GGAGAACATGTAGGGCCTTTCAATCTTGGAAACCCTGGTGAATTCACCATGCTCGAACTCGCTCAGGTTGTTACTTACTCAAAATGTGGT
GATTGTAGTACTGAACTCTACCTTAATCAGCTCGCXTTCTTTGACATGTTCTTAGTACCCTTTAATAGCTATCAGAAAAATTCTAGGCTT
CTTGAACATTCACATGGTGGAGGACCTTTCATTGTACAAGGGGAACACATTGTTGAAACTTGGATCTCAAATTTCAAGAGTGGTTTACAA
TGTCCAAAGTCTCACATAGATGAGATTCAAAGGGCAAAAGAGGCCTTTTCTGTTACAAGAAGCTTCCACGTTTCGAGTATTAAGGAGATT
GTGTTTGTGTGGGACCTTTTGGCATGA
Edits in Original Sequence 
(5')CCGGTTTTTGCTAACCAGCACCAGCGAGGTGTAXCGGCGACCCTCTGCAACATCCACAAGTCGAAACCTACTGGGGCAATGTCAAC
CCCATCGGTGTCCGAAGTTGTTACGATGAGGGAAAGCXGGACTGCTGAAACGTTGACAATGGACTACCACAGGGGTGCCGATGTTGAGGT
GAGGATTGCTAGGATCTTTAATACCTATGGACCTAGAATGTTTCTTGATGATGGTCGTGTTGTCAGCAATTTTGTTGCTCAGGCCTTGAG
GAAGGAACCATTGACAGTTTATGGTGATGGGAAACAGACCAGAAGTTTCCAATACGTTTCAGATCTGGTTGAGGGTCTTATGCGCTTGAT
GGAAGGAGAACATGTAGGGCCTTTCAATCTTGGAAACCCTGGTGAATTCACCATGCTCGAACTCGCTCAGGTaTGTTACTTACTCAAAAT
GTGGTGATTGTAGTACTGAACTCTACCTTAATCAGCTCGCXTTCTTTGACATGTTCTTAGTACCCTTTAATAGCTATCAGAAAAATTCTA
GGCTTCTTGAACATTCACATGGTGGAGGACCTTTCATTGTACAAGGGGAACACATTGTTGAAACTTGGATCTCAAATTTCAAGAGTGtGT
TTACAATGTCCAAAGTCTCACATAGATGAGATTCAAAGGGCAAAAGAGGCCTTTTCTGTTACAAGAAGCTTCCACGTTTCGAGTATTAAG
GAGATTGTGTTTGTGTGGGACCTTTTGGCATGA(3')GTTGACTGACAAATATGTAGAAGTGTAAGGTGTAAGCACCTTTGGAGAAATAT
GCATGTTATAGGAAGATGAAGAATGCTCCCATTGAGTTCTACCTCTAGACATGAGAGCACTGTCCTGTGGATATGCTGGTTGAATCTCTT
GACAACTAGAGATCAGTTTTAGCTGATTCTTACACGATTTGAAATTTATATCTTCACCTTTCCAATTTTTTTTTTTTTCATTCATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan