Notice: After server upgrades, BLAST should be back now. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U301952

Score 
140
Direction 
Forward
Predicted Peptide Sequence 
VEPAFITVLTEIYRIVSKKSLVANEEAESEGKSALLTGTKIVVPSQEPVPGGTKTAVVDLHXENPFMGNISLYTMKQGFRLTV
Predicted Coding Sequence 
GTCGAACCTGCATTCATTACAGTTCTAACAGAGATATATCGAATTGTCAGCAAGAAATCGCTTGTCGCAAATGAGGAAGCAGAATCAGAA
GGAAAATCAGCTCTTCTCACGGGAACCAAGATAGTTGTCCCTAGCCAGGAGCCTGTACCAGGGGGAACAAAGACAGCTGTTGTGGATCTT
CATGAXGAGAACCCTTTCATGGGAAATATATCTCTTTACACTATGAAGCAAGGATTCCGTCTAACTGTCTAG
Edits in Original Sequence 
(5')GTCGAACCTGCATTCATTACAGTTCTAACAGAGATATATCGAATTGTCAGCAAGAAATCGCTTGTCGCAAATGAGGAAGCAGAATC
AGAAGGAAAATCAGCTCTTCTCACGGGAACCAAGATAGTTGTCCCTAGCCAGGAGCCTGTACCAGGGGGAACAAAGtACAGCTGTTGTGG
ATCTTCATGAXGAGAACCCTTTCATGGGAAATATATCTCTTTACACTATGAAGCAAGGATTCCGTCTAACTGTCTAG(3')ACACATACA
AACACACACCATATACATCTCTCTGTAGTGCATGCTAGGATTAAGCGCACGTCTTTTTGAAAAATCTCAACAGGTAATTCTTCCAAGGAG
ATGCTGCTGAGTGAATTACAGATCCCACTATATGAGAGGTCAGTTTTCCCCTCATTTTCCAGAACTCGTTGTCATCTAATAGTGTTGGTG
TTGCTCGGATATTCTAAATAAACCTTGATGCTTTCGGGTCTTGCAAAAAAGTGAAGCCGAGAAGAGTCCTCACCTCAAATTTAGAGCGCA
ACACTTGTTATTTTGAGTGAACTGAAGCTTAAATCAAGTACAAATGCATTCATCTCTGCTTGCTGTATAATAAATACGTCCTTGTGACCT
ATGTTGACAATGCTGTTCGTGGTGGGCGATTGTATGAGCAGCTTTCTACCAGAGTCTGTGCATTAATTTTTCCTGTATGTTCCGGGCTTA
TTTGAAAACTCTGTTGTCGGGCATAAGTATGCTAGTTTAATGCATTTCACAAATGTGGTGCTTTCTAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan