ESTScan Details for Unigene SGN-U301953

Score 
513
Direction 
Forward
Predicted Peptide Sequence 
GLHEFGTRQRSTIPGISRPTAXLSLNQPSAKTTNASAAAAASETLKVAFAAGGTGGHISPAVAIADELKNQNPDIQILFIGTPTGMESAA
VPFAGYPFVAIPAAPLARPLISVHNIFILPFLXDKIPRQKLPNPSRVQPTNSNGTGGYVSFPICLAAAMKGLKLVIQEQNSVPGIANWVL
SLFAEKVFVAFNSSVDCFWQRNKCIVCGNPVRFSLSKNVVKADARKHFFPKAV
Predicted Coding Sequence 
XXCGGGCTGCATGAATTCGGCACGAGGCAACGCTCCACTATTCCAGGAATTTCAAGACCAACAGCTGXTCTTTCTCTCAATCAACCTAGT
GCAAAAACCACCAATGCCTCAGCAGCGGCAGCCGCCTCAGAAACTCTCAAAGTTGCATTCGCCGCCGGTGGGACCGGAGGCCACATATCC
CCCGCTGTGGCAATTGCAGATGAGCTTAAAAACCAAAACCCTGACATCCAAATCCTCTTCATAGGCACCCCGACCGGGATGGAAAGCGCC
GCCGTCCCCTTCGCCGGCTACCCATTTGTCGCCATCCCGGCAGCCCCTTTAGCCCGCCCTTTAATCTCTGTTCACAACATCTTCATCCTT
CCTTTCCTTCXTGACAAAATCCCTCGTCAAAAGCTTCCAAACCCTTCAAGAGTTCAGCCCACAAATAGTAATGGCACTGGTGGCTATGTT
TCTTTCCCCATTTGCCTAGCTGCAGCAATGAAAGGTTTAAAATTGGTAATACAAGAGCAAAATTCAGTTCCTGGAATTGCAAATTGGGTG
CTTTCTTTATTTGCTGAGAAAGTTTTTGTAGCATTTAATTCTAGTGTGGACTGTTTTTGGCAAAGGAATAAGTGTATAGTCTGTGGGAAT
CCAGTGAGGTTTTCTTTGAGCAAGAATGTGGTGAAGGCTGATGCAAGAAAGCATTTTTTCCCTAAGGCAGTX
Edits in Original Sequence 
(5')XXCGGGCTGCATGAATTCGGCACGAGGCAACGCTCCACTATTCCAGGAATTTCAAGACCAACAGCTGXTCTTTCTCTCAATCAACC
TAGTGCAAAAACCACCAATGCCTCAGCAGCGGCAGCCGCCTCAGAAACTCTCAAAGTTGCATTCGCCGCCGGTGGGACCGGAGGCCACAT
ATCCCCCGCTGTGGCAATTGCAGATGAGCTTAAAAACCAAAACCCTGACATCCAAATCCTCTTCATAGGCACCCCGACCGGGATGGAAAG
CGCCGCCGTCCCCTTCGCCGGCTACCCATTTGTCGCCATCCCGGCAGCCCCTTTAGCCCGCCCTTTAATCTCTGTTCACAACATCTTCAT
CCTTCCTTTCCTTCXTGACAAAATCCCTCGTCAAAAGCTTCCAAACCCTTCAAGAGTTCAGCCCACAAATAGTAATcGGCACTGGTGGCT
ATGTTTCTTTCCCCATTTGCCTAGCTGCAGCAATGAAAGGTTTAAAATTGGTAATACAAGAGCAAAATTCAGTTCCTGGAATTGCAAATT
GGGTGCTTTCTTTATTTGCTGAGAAAGTTTTTGTAGCATTTAATTCTAGTGTGGACTGTTTTTGGCAAAGGAATAAGTGTATAGTCTGTG
GGAATCCAGTGAGGTTTTCTTTGAGCAAGAATGTGGTGAAGGCTGATGCAAGAAAGCATTTTTTCCCTAAGGCAGTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan