ESTScan Details for Unigene SGN-U302004

Score 
356
Direction 
Forward
Predicted Peptide Sequence 
PVSSHLPRKLEVGTNNLLSPGRCPRESSPPPSPXDAPDRIPPIGKRDPKNSTSPPPGSESTFNDEFSLDYKPXVNLQLPHFYDPKGEMNE
VMTAADASSSLRPYSSPHSIYPSNLPLVSAXPRLSCCPISQDLYPLVQGEEMGFEKDASSGGMPSSHSATVTALAVAIGLQDGAGTSAFA
IAVVLACVVMYDATGVRLHAGRQAELLNQIVCELPPEHPVANVRPLRDSLGHTPFQVVAGALLGCVVAYLLVALLRXGAGDSSEPSAKEA
FVLSDSFRLQLDX
Predicted Coding Sequence 
CCGGTTTCTTCCCATCTTCCTCGCAAGCTGGAAGTTGGAACCAACAATTTACTTAGCCCGGGCAGGTGCCCGCGTGAGTCCTCACCACCA
CCCTCCCCCGXCGACGCCCCTGACCGAATTCCTCCAATTGGAAAGCGAGACCCAAAAAACTCCACGTCTCCACCTCCGGGATCCGAATCC
ACGTTCAACGACGAGTTTTCTCTAGATTATAAGCCCTAAGTCAACCTGCAACTTCCACATTTTTATGATCCAAAAGGTGAAATGAACGAA
GTAATGACGGCAGCTGATGCATCCTCCAGCTTACGCCCCTACTCATCTCCACACTCCATTTATCCCTCCAATCTCCCCCTTGTCTCCGCT
XTTCCTCGCTTGTCTTGTTGCCCAATTTCTCAAGATCTTTACCCATTGGTTCAAGGAGAGGAAATGGGATTCGAGAAGGATGCTAGCTCT
GGTGGAATGCCGTCATCACATTCAGCAACTGTTACTGCTCTTGCTGTAGCAATAGGTTTGCAAGATGGAGCGGGAACATCTGCTTTTGCC
ATTGCGGTCGTTTTGGCATGTGTTGTAATGTATGATGCTACTGGTGTTAGGCTTCATGCCGGTCGGCAGGCTGAATTATTGAATCAGATA
GTTTGTGAATTGCCCCCTGAACATCCTGTCGCTAATGTTAGGCCTCTGCGAGATTCACTTGGTCACACTCCTTTCCAGGTTGTTGCTGGT
GCTTTGCTTGGATGTGTGGTAGCCTATCTCCTGGTAGCTCTGCTTAGAXATGGTGCTGGTGATTCTTCAGAGCCAAGTGCTAAAGAGGCT
TTTGTACTTTCTGATTCGTTCAGGCTGCAGCTTGACTXX
Edits in Original Sequence 
(5')CCGGTTTCTTCCCATCTTCCTCGCAAGCTGGAAGTTGGAACCAACAATTTACTTAGCCCGGGCAGGTGCCCGCGTGAGTCCTCACC
ACCACCCTCCCCCGXCGACGCCCCTGACCGAATTCCTCCAATTGGAAAGCGAGACCCAAAAAACTCCACGTCTCCACCTCCGGGATCCGA
ATCCACGTTCAACGACGtAGTTTTCTCTAGATTATAAGCCCTAAGTCAACCTGCAACTTCCACATTTTTATGATCCAAAAGGTGAAATGA
ACGAAGTAATGACGGCAGCTGATGCATCCTCCAGCTTACGCCCCTACTCATCTCCACACTCCATTTATCCCTCCAATCTCCCCCTTGTCT
CCGCTXTTCCTCGCTTGTCTTGTTGCCCAATTTCTCAAGATCTTTACCCATTGGTTCAAGGAGAGGAAATGGGATTCGAGAAGGATGCtT
AGCTCTGGTGGAATGCCGTCATCACATTCAGCAACTGTTACTGCTCTTGCTGTAGCAATAGGTTTGCAAGATGGAGCGGGAACATCTGCT
TTTGCCATTGCGGTCGTTTTGGCATGTGTTGTAATGTATGATGCTACTGGTGTTAGGCTTCATGCCGGTCGGCAGGCTGAATTATTGAAT
CAGATAGTTTGTGAATTGCCCCCTGAACATCCTGTCGCTAATGTTAGGCCTCTGCGAGATTCACTTGGTCACACTCCTTTCCAGGTTGTT
GCTGGTGCTTTGCTTGGATGTGTGGTAGCCTATCTCCTGaGTAGCTCTGCTTAGAXATGGTGCTGGTGATTCTTCAGAGCCAAGTGCTAt
AAGAGGCTTTTGTACTTTCTGATTCGTTCAGGCTGCAGCTTGACTXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan