Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U302100

Score 
724
Direction 
Forward
Predicted Peptide Sequence 
IPRAAGXEFRTEIEMLSQFRHRHLVSLIGYCDEKNEMILIYEYMENGTVKSHLYGTDLPSLSWKLRLEICIGAARGLHYLHTGSTKAIIH
RDVKSANILLDENFLAKVADFGLSKSGPEVDQTHVSTAVKGSFGYLDPEYFRRQQLTEKSDVYSFGVVLLEVLCARPVIDPSLPREMVNL
AEWAMKWQKKGQLEQIIDPNLVGKIRPDSLRKYGETAEKCLADFGVDRPTMGDVLWNLEYALQLQEAVIQNDPEENSTNAIGELSPQVNN
FHHADYSPSAAEMSHVDDLSGVSXEQGLLTTREV
Predicted Coding Sequence 
XXGATCCCCCGGGCTGCAGGTXCTGAGTTCAGAACTGAAATTGAGATGCTTTCACAATTCAGGCACAGACATTTGGTATCACTGATTGGA
TACTGTGATGAAAAGAATGAGATGATTCTAATTTATGAATACATGGAAAATGGGACAGTCAAGAGTCATCTCTATGGCACTGATCTTCCC
AGTTTGAGTTGGAAACTGAGGCTTGAGATATGCATTGGGGCAGCCAGAGGACTACACTACCTTCATACGGGCTCAACAAAAGCTATCATA
CATCGTGATGTAAAATCTGCAAATATATTGCTGGATGAGAACTTTTTGGCAAAGGTTGCTGATTTTGGACTTTCTAAGAGTGGACCGGAG
GTTGATCAAACCCATGTGAGTACAGCCGTAAAGGGAAGTTTTGGCTATCTCGATCCCGAATATTTCAGAAGGCAGCAGCTGACTGAAAAA
TCAGATGTTTACTCTTTTGGGGTCGTATTGCTTGAGGTTCTATGTGCAAGGCCTGTGATAGATCCATCTCTTCCACGTGAGATGGTGAAT
TTAGCTGAATGGGCTATGAAGTGGCAGAAGAAAGGACAGCTGGAGCAGATTATAGATCCTAATCTTGTTGGAAAAATTAGACCGGATTCC
CTCAGGAAGTATGGAGAAACAGCAGAGAAGTGCTTGGCAGATTTTGGGGTAGACAGACCTACAATGGGAGATGTCCTGTGGAATCTGGAA
TACGCACTTCAACTTCAAGAAGCTGTAATTCAAAATGATCCTGAAGAAAACAGTACCAATGCCATTGGTGAGCTCTCTCCACAAGTCAAT
AATTTCCATCATGCTGATTATTCTCCTTCAGCCGCTGAAATGTCTCATGTGGATGATCTTTCGGGTGTTTCTXATGAGCAGGGTCTTCTC
ACAACTCGTGAAGTCTGA
Edits in Original Sequence 
(5')XXGATCCCCCGGGCTGCAGGTXCTGAGTTCAGAACTGAAATTGAGATGCTTTCACAATTCAGGCACAGACATTTGGTATCACTGAT
TGGATACTGTGATGAAAAGAATGAGATGATTCTAATTTATGAATACATGGAAAATGGGACAGTCAAGAGTCATCTCTATGGCACTGATCT
TCCCAGTTTGAGTTGGAAACTGAGGCTTGAGATATGCATTGGGGCAGCCAGAGGACTACACTACCTTCATACGGGCTCAACAAAAGCTAT
CATACATCGTGATGTAAAATCTGCAAATATATTGCTGGATGAGAACTTTTTGGCAAAGGTTGCTGATTTTGGACTTTCTAAGAGTGGACC
GGAGGTTGATCAAACCCATGTGAGTACAGCCGTAAAGGGAAGTTTTGGCTATCTCGATCCCGAATATTTCAGAAGGCAGCAGCTGACTGA
AAAATCAGATGTTTACTCTTTTGGGGTCGTATTGCTTGAGGTTCTATGTGCAAGGCCTGTGATAGATCCATCTCTTCCACGTGAGATGGT
GAATTTAGCTGAATGGGCTATGAAGTGGCAGAAGAAAGGACAGCTGGAGCAGATTATAGATCCTAATCTTGTTGGAAAAATTAGACCGGA
TTCCCTCAGGAAGTATGGAGAAACAGCAGAGAAGTGCTTGGCAGATTTTGGGGTAGACAGACCTACAATGGGAGATGTCCTGTGGAATCT
GGAATACGCACTTCAACTTCAAGAAGCTGTAATTCAAAATGATCCTGAAGAAAACAGTACCAATGCCATTGGTGAGCTCTCTCCACAAGT
CAATAATTTCCATCATGCTGATTATTCTCCTTCAGCCGCTGAAATGTCTCATGTGGATGATCTTTCGGGTGTTTCTXATGAGCAGGGTCT
TCTCACAACTCGTGAAGTCTGA(3')GGGTCGATAACTGAAGTGAAAAATGTGTTATGTGCAATGTGTTTAGATCTTCTCCCAATGCCAT
AGTAGTTTTTCTTTACCGCTACCTGTAAGAGTGAATCTAAAGTTACAGCCTCATATAGGGATTCAGGGATTCTCATTTTCTAGATCCATG
TATGTTCTGTTATTTATGTTCATATAAATTCTTCTCGTTATATATGTTGGTCTGCCTCTCAGCTTATCTATCTTTCTTACCAAAAAAAAA
AAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan