ESTScan Details for Unigene SGN-U302123

Score 
409
Direction 
Forward
Predicted Peptide Sequence 
PLFPGLPPPPPDHTLLSDGKHPTQPSGLYVSLSVSLGVLATTFLIFSIYMIYKFYKRRYTSSRSRQLIPQPQQQPREDEEAHLDFLDEDQ
GPVVDHPIWYIRTVGLQPSVINAITICKYKRGDGLVEGTECSVCLNEFQEDETXKAAAQXVIMLFIYLALILGSDHTPIAPIAXAGIVVS
TANLQSSSQSHHNSGRVEEIQMGVSENNRDSERERERESEVLEVG
Predicted Coding Sequence 
XATCCACTCTTTCCCGGTCTGCCTCCACCACCTCCTGATCATACTTTGCTTTCTGATGGCAAGCATCCTACCCAGCCATCTGGACTCTAT
GTCTCCCTCTCCGTGTCTCTTGGTGTTTTAGCCACAACTTTCTTGATTTTCTCTATCTACATGATATACAAGTTTTATAAACGTCGGTAT
ACGTCTTCAAGGAGTAGGCAATTGATTCCACAGCCCCAGCAGCAGCCTCGAGAGGATGAAGAAGCCCATCTGGATTTTCTTGATGAAGAT
CAGGGTCCCGTGGTTGACCATCCCATATGGTATATCAGGACAGTTGGTCTTCAGCCGTCTGTGATTAATGCAATCACTATTTGTAAGTAT
AAAAGAGGTGATGGACTGGTGGAAGGAACAGAGTGCTCTGTTTGCTTGAATGAATTTCAAGAAGATGAGACTXTTAAGGCTGCTGCCCAA
GXTGTAATCATGCTTTTCATATACCTTGCATTGATACTTGGCTCAGATCACACACCAATTGCCCCAATTGCCGXAGCTGGGATTGTTGTG
AGCACGGCTAACCTCCAGTCTTCGTCGCAGAGTCATCATAATTCAGGTCGTGTGGAGGAAATCCAAATGGGAGTTTCGGAAAATAATAGG
GATTCCGAGAGAGAAAGGGAAAGGGAAAGTGAGGTTCTTGAAGTCGGT
Edits in Original Sequence 
(5')XATCCACTCTTTCCCGGTCTGCCTCCACCACCTCCTGATCATACTTTGCTTTCTGATGGCAAGCATCCTACCCAGCCATCTGGACT
CTATGTCTCCCTCTCCGTGTCTCTTGGTGTTTTAGCCACAACTTTCTTGATTTTCTCTATCTACATGATATACAAGTTTTATAAACGTCG
GTATACGTCTTCAAGGAGTAGGCAATTGATTCCACAGCCCCAGCAGCAGCCTCGAGAGGATGAAGAAGCCCATCTGGATTTTCTTGATGA
AGATCAGGGTCCCGTGGTTGACCATCCCATATGGTATATCAGGACAGTTGGTCTTCAGCCGTCTGTGATTAATGCAATCACTATTTGTAA
GTATAAAAGAGGTGATGGACTGGTGGAAGGAACAGAGTGCTCTGTTTGCTTGAATGAATTTCAAGAAGATGAGACTXTTAAGGCTGCTGC
CCAAGXTGTAATCATGCTTTTCATATACCTTGCATTGATACTTGGCTCAGATCACACACCAATTGCCCCAATTGCCGXAGCTGGGATTGT
TGTGAGCACGGCTAACCTCCAGTCTTCGTCGCAGAGTCATCATAATTCAGGTCGTGTGGAGGAAATCCAAATGGGAGTTTCGGAAAATAA
TAGGGATTCCGAGAGAGAAAGGGAAAGGGAAAGTGAGGTTCTTGAAGTCGGT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan