ESTScan Details for Unigene SGN-U302165

Score 
781
Direction 
Forward
Predicted Peptide Sequence 
NLFGGVKFQNFNFNEEETTRHIAIIVLCSTLLALGERLLSLSEVHCRQQEQQHNLGFCGEEEEEFADQLIRMATVGGLHDSTSPSSQQNN
SEIDALARFAIQEHNKKENALFELVRVVEAREQVVAGTLHHLTLEVIDAGKKKLYEAKVWVKPWLNFKELQEFKHVEDIPSFTPSDLGIK
KDGHGLGWQSVPAHDPIVQDAANHALATIQQRSNSLFAYELLEILHANAEVAEESARFDLHLKVRRGGREEKFKVEVNRNSEGYFHLNHM
DRYSLDSYLGWHDLGTLRIAAGCCQTSEVADMFFLTVLSNSSEDAFAFLACLSYKGPMFNKNASSGFDLEGLCFCVLQTVGYQSAECFTV
TKSELLFIDLGMFGSVIILEKYL
Predicted Coding Sequence 
AACTTATTCGGTGGTGTGAAATTTCAAAATTTTAATTTTAATGAAGAGGAGACAACTCGCCACATTGCCATAATTGTCCTCTGCAGCACT
CTGCTTGCTTTGGGTGAGCGTCTGCTTTCCCTATCCGAGGTTCATTGTCGTCAACAAGAACAACAGCACAACTTAGGGTTTTGCGGTGAA
GAAGAGGAAGAATTCGCAGATCAACTGATTCGGATGGCAACTGTCGGAGGATTACACGATTCTACTTCTCCATCATCGCAGCAGAATAAC
TCTGAGATTGACGCCCTTGCTCGATTTGCTATCCAGGAACACAACAAGAAAGAGAATGCATTGTTTGAGTTGGTGAGGGTGGTTGAAGCA
CGAGAACAAGTTGTTGCTGGGACACTGCACCATCTTACTCTTGAGGTCATTGATGCTGGAAAGAAAAAGCTGTATGAAGCTAAGGTGTGG
GTGAAACCTTGGTTAAACTTTAAAGAACTGCAAGAATTCAAGCATGTTGAGGACATTCCCTCTTTTACTCCCTCTGATCTTGGCATCAAG
AAAGATGGCCATGGCTTGGGATGGCAATCAGTGCCAGCACATGATCCGATTGTCCAAGATGCTGCAAACCATGCGCTTGCAACCATCCAG
CAGAGATCTAACTCGCTTTTTGCTTATGAGCTTCTTGAGATACTTCATGCAAATGCTGAGGTTGCTGAAGAATCTGCTAGGTTTGATCTG
CATCTTAAGGTCAGAAGGGGGGGGAGAGAGGAGAAATTCAAGGTTGAGGTTAACAGGAATAGTGAAGGTTATTTCCACTTGAATCACATG
GACCGCTACAGTCTTGATTCGTATCTAGGTTGGCATGACCTTGGTACTTTGAGGATCGCTGCTGGTTGTTGTCAGACGTCTGAAGTGGCC
GATATGTTTTTCTTAACTGTATTAAGCAATTCTAGTGAGGATGCTTTTGCCTTCCTTGCTTGCTTGTCATATAAAGGGCCTATGTTTAAT
AAGAATGCTTCTTCTGGATTTGATCTAGAGGGCTTATGTTTTTGTGTCCTGCAAACGGTGGGTTACCAATCTGCGGAATGTTTCACTGTA
ACCAAATCAGAGCTCCTCTTCATTGATTTAGGTATGTTTGGATCTGTGATTATTTTGGAAAAGTATTTGTAA
Edits in Original Sequence 
(5')AACTTATTgCGGTGGTGTGAAATTTCAAAATTTTAATTTTAATGAAGAGGAGACAACTCGCCAgCATTGCCATAATTGTCCTCTGC
AGCACTCTGCTTGCTTTGGGTGAGCGTCTGCTTTCCCTATCCGAGGTTCATTGTCGTCAACAAGAACAACAGCACAACTTAGGGTTTTGC
GGTGAAGAAGAGGAAGAATTCGCAGATCAACTGATTCGGATGGCAACTGTCGGAGGATTACACGATTCTACTTCTCCATCATCGCAGCAG
AATAACTCTGAGATTGACGCCCTTGCTCGATTTGCTATCCAGGAACACAACAAGAAAGAGAATGCATTGTTTGAGTTGGTGAGGGTGGTT
GAAGCACGAGAACAAGTTGTTGCTGGGACACTGCACCATCTTACTCTTGAGGTCATTGATGCTGGAAAGAAAAAGCTGTATGAAGCTAAG
GTGTGGGTGAAACCTTGGTTAAACTTTAAAGAACTGCAAGAATTCAAGCATGTTGAGGACATTCCCTCTTTTACTCCCTCTGATCTTGGC
ATCAAGAAAGATGGCCATGGCTTGGGATGGCAATCAGTGCCAGCACATGATCCGATTGTCCAAGATGCTGCAAACCATGCGCTTGCAACC
ATCCAGCAGAGATCTAACTCGCTTTTTGCTTATGAGCTTCTTGAGATACTTCATGCAAATGCTGAGGTTGCTGAAGAATCTGCTAGGTTT
GATCTGCATCTTAAGGTCAGAAGGGGGGGGAGAGAGGAGAAATTCAAGGTTGAGGTTAACAGGAATAGTGAAGGTTATTTCCACTTGAAT
CACATGGaACCGCTACAGTCTTGATTCGTATCTAGGTTaGGCATGACCTTGGTACTTTGAGGATCGCTGCaTGGTTGTTGTCAGACGTCT
GAAGTGGCCGATATGTTTTTCTTAACTGTATTAAGCAATTCTaAGTGAGGATGCTTTTGCCTTCgCTTGCTTGCTTGTCATATAAAGGGC
CTATGTTTAATAAGAATGCTTCTTCTGGATTTGATCTAGAGGGCTTATGTTTTTGTGTCCTGCAAACGGTGGGTTACCAATCTGCGGAAT
GTTTCACTGTAACCAAATCAGAGCTCCTCTTCATTGATTTAGGTATGTTTGGATCTGTGATTATTTTGGAAAAGTATTTGTAA(3')TTG
TAATGCTAACATGCCTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan