Notice: SGN will be briefly unavailable for maintenance. Apologies.

ESTScan Details for Unigene SGN-U302332

Score 
617
Direction 
Forward
Predicted Peptide Sequence 
HAAYXYIMKMTRTWDSTMSMIPKGGDTIWGGLDWSPEEGYLPSKRKKHRSNAADCSADNENVSTESKAKNIVNYGRIISFGKDVAEAHSS
EIKKIDFRDAVKGSNTANNTCRDVWTEYHDMGLVGIKAVAEYKVYTAGELVDLLNFVAPKMMARGNAHFSYGIADDLDDPKYAHYKYWSN
PLETKLPNAPEMEIYSMYGVGIPTERAYVYRQSPSSECYIPFQIDTSADEDDKDKRLKDGVFTVDGDETVPALSAGYMCAKGWRGKTRFN
PSGIKTYVREYDHAPPSNLLLEGRGTESGAHVDIMGNFALIEDIIRVAAGATGEELGGDQVYSDIFKWSEKINYLYKMNAGKTNLNALSI
CGCDXYTGIHAAVFLEVV
Predicted Coding Sequence 
XXGCACGCGGCTTACAAXTACATAATGAAGATGACACGAACATGGGATTCGACAATGTCAATGATTCCAAAAGGTGGTGACACCATTTGG
GGTGGTCTTGATTGGTCACCTGAAGAAGGCTACCTTCCCAGTAAGAGGAAAAAGCACAGATCGAACGCTGCTGACTGCTCAGCTGACAAT
GAGAATGTCAGCACAGAATCTAAGGCAAAAAATATCGTCAATTACGGAAGGATAATATCATTCGGAAAAGATGTGGCAGAAGCACATTCT
TCTGAGATCAAGAAGATTGACTTTAGGGATGCCGTTAAAGGTAGCAATACTGCAAATAATACTTGTCGTGATGTCTGGACAGAGTATCAT
GACATGGGTTTGGTTGGCATCAAAGCTGTTGCAGAATACAAGGTTTATACAGCTGGAGAACTTGTAGATTTGTTGAATTTTGTTGCCCCC
AAAATGATGGCACGTGGCAATGCGCACTTCTCCTATGGAATAGCTGATGACCTGGACGACCCTAAGTATGCGCACTACAAATATTGGTCA
AACCCATTGGAAACAAAGTTGCCAAACGCTCCCGAAATGGAGATCTACTCAATGTATGGAGTCGGTATCCCAACTGAGAGAGCATACGTT
TATAGGCAGTCCCCTTCCTCAGAATGCTATATTCCCTTCCAGATTGATACGTCGGCAGATGAAGATGACAAAGATAAGCGTTTGAAAGAT
GGTGTTTTTACTGTCGATGGGGATGAGACGGTGCCTGCTTTAAGTGCAGGTTACATGTGTGCAAAAGGGTGGCGGGGGAAAACTAGATTC
AATCCTTCAGGAATCAAAACTTATGTAAGGGAGTATGATCATGCTCCACCGTCTAATCTTCTTCTGGAGGGTCGTGGCACCGAGAGTGGT
GCGCATGTTGACATAATGGGTAATTTTGCTCTTATCGAGGACATTATCAGGGTTGCTGCCGGGGCTACCGGCGAGGAGTTGGGAGGTGAT
CAGGTGTACTCAGACATCTTCAAGTGGTCTGAGAAAATTAACTACCTCTATAAGATGAATGCAGGGAAGACAAATTTAAATGCCCTTAGC
ATCTGTGGTTGTGATXTTTACACTGGAATTCATGCAGCGGTCTTTCTGGAAGTGGTCTGA
Edits in Original Sequence 
(5')XXGCACGCGGCTTACAAXTACATAATGAAGATGACACGAACATGGGATTCGACAATGTCAATGATTCCAAAAGGTGGTGACACCAT
TTGGGGTGGTCTTGATTGGTCACCTGAAGAAGGCTACCTTCCCAGTAAGAGGAAAAAGCACAGATCGAACGCTGCTGACTGCTCAGCTGA
CAATGAGAATGTCAGCACAGAATCTAAGGCAAAAAATATCGTCAATTACGGAAGGATAATATCATTCGGAAAAGATGTGGCAGAAGCACA
TTCTTCTGAGATCAAGAAGATTGACTTTAGGGATGCCGTTAAAGGTAGCAATACTGCAAATAATACTTGTCGTGATGTCTGGACAGAGTA
TCATGACATGGGTTTGGTTGGCATCAAAGCTGTTGCAGAATACAAGGTTTATACAGCTGGAGAACTTGTAGATTTGTTGAATTTTGTTGC
CCCCAAAATGATGGCACGTGGCAATGCGCACTTCTCCTATGGAATAGCTGATGACCTGGACGACCCTAAGTATGCGCACTACAAATATTG
GTCAAACCCATTGGAAACAAAGTTGCCAAACGCTCCCGAAATGGAGATCTACTCAATGTATGGAGTCGGTATCCCAACTGAGAGAGCATA
CGTTTATAGGCAGTCCCCTTCCTCAGAATGCTATATTCCCTTCCAGATTGATACGTCGGCAGATGAAGATGACAAAGATAAGCGTTTGAA
AGATGGTGTTTTTACTGTCGATGGGGATGAGACGGTGCCTGCTTTAAGTGCAGGTTACATGTGTGCAAAAGGGTGGCGGGGGAAAACTAG
ATTCAATCCTTCAGGAATCAAAACTTATGTAAGGGAGTATGATCATGCTCCACCGTCTAATCTTCTTCTGGAGGGTCGTGGCACCGAGAG
TGGTGCGCATGTTGACATAATGGGTAATTTTGCTCTTATCGAGGACATTATCAGGGTTGCTGCCGGGGCTACCGGCGAGGAGTTGGGAGG
TGATCAGGTGTACTCAGACATCTTCAAGTGGTCTGAGAAAATTaAACTACCTCTATAAGATGAATGCAGGcGAAGACAAATTTAAATGCC
CTTAGCATCTGTGGTTGTGATXTTTACACTGGAATTCATGCAGCGGTCTTTCTGGAAGTGGTCTGA(3')TTTTACAGTTTTTGTGGTAA
TCCAAATTTCTTTCTTCCAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan