ESTScan Details for Unigene SGN-U302356

Score 
812
Direction 
Forward
Predicted Peptide Sequence 
MDPNPKPNPKPEDHPHSADYAPYPKLDTQDITPPPPTTTDTWTSVPVGSDPPPPSSQPPQGPNPQTEPASYTAAPRSPQAPPPPAAHPLP
GASAATSMPPESNPYVSPAPAGGSGSSVKNTVDSVKDVLGKWGKKAAEATKKGQDLAGNMWQHLKTGPSMADAAVGRIAQGTKIFAEGGY
EKVFKQTFETAPEEKLLKYYACYLSTSAGPVMGVLYLSTAKLAFSSDNPLSYKVGEETQWSYYKVVIPLHQLKAVNSSTSKINSAENQPE
ASRTVGLPXLAVSSGMVGHAALFGCTTV
Predicted Coding Sequence 
ATGGATCCCAACCCAAAACCCAACCCGAAACCCGAAGATCATCCTCACTCCGCCGACTACGCTCCGTACCCGAAACTCGATACCCAAGAC
ATAACTCCCCCTCCTCCCACCACTACCGACACCTGGACCTCCGTTCCTGTCGGGTCGGATCCTCCTCCTCCCTCGTCCCAACCACCGCAA
GGTCCAAACCCACAAACAGAACCGGCGTCGTATACTGCTGCTCCCAGGTCTCCCCAAGCTCCACCACCACCTGCAGCTCATCCCCTCCCC
GGCGCCTCTGCTGCAACCTCCATGCCACCTGAATCCAACCCCTACGTCTCTCCCGCTCCCGCCGGTGGCTCCGGGTCTTCGGTTAAAAAT
ACGGTGGACTCCGTAAAGGATGTGCTGGGGAAATGGGGAAAGAAGGCAGCAGAAGCCACGAAAAAGGGCCAGGATCTGGCTGGGAACATG
TGGCAACATCTAAAAACAGGCCCAAGTATGGCTGATGCGGCTGTTGGAAGAATAGCTCAGGGAACAAAGATCTTTGCCGAAGGTGGTTAT
GAGAAAGTATTCAAACAAACATTTGAGACGGCCCCAGAAGAGAAACTTCTTAAATACTACGCCTGTTACCTGTCTACATCTGCTGGTCCT
GTCATGGGAGTCCTCTATTTGTCAACTGCAAAGCTAGCATTTTCAAGTGATAATCCCCTTTCTTATAAAGTTGGTGAGGAGACTCAATGG
AGCTATTATAAGGTGGTTATCCCGTTGCATCAGCTGAAAGCAGTTAATTCTTCAACAAGTAAAATCAATTCAGCTGAGAATCAGCCTGAG
GCCAGTAGAACTGTGGGACTTCCTGXACTAGCAGTCAGTAGCGGGATGGTAGGCCATGCTGCTCTCTTTGGTTGCACTACTGTATAA
Edits in Original Sequence 
(5')ATGGATCCCAACCCAAAACCCAACCCGAAACCCGAAGATCATCCTCACTCCGCCGACTACGCTCCGTACCCGAAACTCGATACCCA
AGACATAACTCCCCCTCCTCCCACCACTACCGACACCTGGACCTCCGTTCCTGTCGGGTCGGATCCTCCTCCTCCCTCGTCCCAACCACC
GCAAGGTCCAAACCCACAAACAGAACCGGCGTCGTATACTGCTGCTCCCAGGTCTCCCCAAGCTCCACCACCACCTGCAGCTCATCCCCT
CCCCGGCGCCTCTGCTGCAACCTCCATGCCACCTGAATCCAACCCCTACGTCTCTCCCGCTCCCGCCGGTGGCTCCGGGTCTTCGGTTAA
AAATACGGTGGACTCCGTAAAGGATGTGCTGGGGAAATGGGGAAAGAAGGCAGCAGAAGCCACGAAAAAGGGCCAGGATCTGGCTGGGAA
CATGTGGCAACATCTAAAAACAGGCCCAAGTATGGCTGATGCGGCTGTTGGAAGAATAGCTCAGGGAACAAAGATCTTTGCCGAAGGTGG
TTATGAGAAAGTATTCAAACAAACATTTGAGACGGCCCCAGAAGAGAAACTTCTTAAATACTACGCCTGTTACCTGTCTACATCTGCTGG
TCCTGTCATGGGAGTCCTCTATTTGTCAACTGCAAAGCTAGCATTTTCAAGTGATAATCCCCTTTCTTATAAAGTTGGTGAGGAGACTCA
ATGGAGCTATTATAAGGTGGTTATCCCGTTGCATCAGCTGAAAGCAGTTAATTCTTCAACAAGTAAAATCAATTCAGCTGAGAATCAGCC
TGAGGCCAGTAGAACTGTGGGACTTCCTGXACTAGCAGTCAGTAGCGGGATGGTAGGCCATGCTGCaTCTCTTTGGTTGCACTACTGTAT
AA(3')ATGAATTTTGGTCAGTTGTGGCGATGTTGGGAATTGTGTACTGTGTTCTTGTTTGGTGTGTTGTAACCAGGCTGTGCAAAATTC
AAACTGAGATTTGTTCAATTAGTTTTGACTTTTCCAATTTGTGAGACTTCCAGATAAAATAAACATGTTATTATGCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan