Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U302518

Score 
264
Direction 
Forward
Predicted Peptide Sequence 
AAVALACFTILINYSTSTGAEYCFCILDFPSFRWGKKRKTNTIGNGQSIMGXWRGEMRKKPXDAQDKKVLLVVLAEHCGKTIXVENEKIC
DVCESAAAIVFCAADEAALCPSCDEKVHMCNKLASRHVRVGLAEPSEVPHCDICESAPAFFYCEVDGSSLCLQCDMLVHVGGKRTHGRYL
LLRQRVEFPGNKPGRSDELGLQPMSPGEARREALQPSKLATNENQQNHNTCPIPMLENDNHVGDKMESKLIDLNARPQRLHGQASSNQEQ
GMEMLSGSNHEX
Predicted Coding Sequence 
XCTGCTGCTGTTGCACTTGCATGCTTCACCATCTTAATAAACTATAGTACTAGCACTGGTGCGGAGTACTGCTTTTGCATTCTTGATTTC
CCTTCCTTTCGGTGGGGGAAAAAGAGGAAGACAAATACAATCGGCAACGGCCAATCAATTATGGGGCXGTGGAGAGGTGAAATGAGAAAG
AAGCCTGAXGATGCACAAGACAAGAAAGTACTCCTTGTAGTCTTAGCTGAGCACTGTGGTAAAACAATCGXGGTAGAGAATGAGAAGATT
TGTGACGTATGCGAGAGCGCTGCCGCCATCGTTTTCTGTGCCGCGGACGAGGCTGCTCTTTGCCCTTCTTGCGATGAAAAGGTCCACATG
TGTAACAAGCTCGCTAGCCGACATGTTAGAGTTGGGCTTGCCGAGCCCAGTGAAGTTCCACACTGTGATATATGCGAAAGTGCACCTGCT
TTCTTTTATTGTGAGGTCGATGGAAGTTCCCTCTGTCTGCAATGTGACATGTTAGTCCATGTTGGGGGAAAAAGAACCCATGGGCGATAT
CTCCTATTGAGGCAGAGAGTTGAGTTTCCAGGGAACAAACCTGGTCGCTCGGACGAGCTGGGATTGCAGCCTATGAGTCCAGGAGAAGCA
AGGAGGGAAGCTCTTCAGCCATCTAAGCTTGCAACAAATGAGAACCAACAAAATCACAATACATGTCCCATTCCAATGCTAGAAAATGAC
AATCATGTTGGAGATAAAATGGAGAGTAAATTGATTGATCTTAATGCTAGACCTCAACGGTTACATGGACAAGCTTCAAGTAATCAGGAA
CAAGGAATGGAAATGTTAAGTGGCAGCAATCATGAATXX
Edits in Original Sequence 
(5')XCTGCTGCTGTTGCACTTGCATGCTTCACCATCTTAATAAACTATAGTACTAGCACTGGTGCGGAGTACTGCTTTTGCATTCTTGA
TTTCCCTTCCTTTCGGTGGGGGAAAAAGAGGAtAGACAAATACAATCGGCAACGGCCAATCAATTATGGGGCXGTGGAGAGGTGAAATGA
GAAAGAAGCCTGAXGATGCACAAGACAAGAAAGTACTCCTTGTAGTCTTAGCTGAGCACTGTGGTAAAACAATCGXGGTAGAGAATGAGA
AcGATTTGTGACGTATGCGAGAGCGCTGCCGCCATCGTTTTCTGTGCCGCGGACGAGGCTGCTCTTTGCCCTTCTTGCGATGAAAAGGTC
CACATGTGTAACAAGCTCGCTAGCCGACATGTTAGAGTTGGGCTTGCCGAGCCCAGTGAAGTTCCACACTGTGATATATGCGAAAGTGCA
CCTGCTTTCTTTTATTGTGAGGTCGATGGAAGTTCCCTCTGTCTGCAATGTGACATGTTAGTCCATGTTGGGGGAAAAAGAACCCATGGG
CGATATCTCCTATTGAGGCAGAGAGTTGAGTTTCCAGGGAACAAACCTGGTCGCTCGGACGAGCTGGGATTGCAGCCTATGAGTCCAGGA
GAAGCAAGGAGGGAAGCTCTTCAGCCATCTAAGCTTGCAACAAATGAGAACCAACAAAATCACAATACATGTCCCATTCCAATGCTAGAA
AATGACAATCATGTTGGAGATAAAATGGAGAGTAAATTGATTGATCTTAATGCTAGACCTCAACGGTTACATGGACAAGCTTCAAGTAAT
CAGGAACAAGGAATGGAAATGTTAAGTGGCAGCAATCATGAATXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan