Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U302578

Score 
761
Direction 
Forward
Predicted Peptide Sequence 
GLFPPALLYHLTALNLDLHRPLARTCKMALPNQQIVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKLR
FYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCESIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEIS
AKSNYNFEKPFLYLARKLAGDPNLHFVESPALLPPEVQIDLAAQQQHEAELAQAAIQPLPDDDDDAVRVNXDGSFAATSQPTTSALFGCK
VYELLDSSSLLRRLAQVGCDLGVGGLSAVGTLVL
Predicted Coding Sequence 
XXCGGACTCTTCCCTCCTGCTCTACTGTATCATCTCACXGCTCTCAATCTCGATCTCCACCGTCCGTTAGCTCGTACTTGCAAAATGGCT
TTGCCTAATCAGCAGATTGTGGATTACCCTAGCTTTAAGCTTGTGATTGTCGGTGATGGAGGAACTGGTAAAACTACTTTTGTCAAGAGG
CACTTGACTGGTGAATTTGAGAAAAAATATGAACCAACTATTGGAGTGGAGGTTCACCCATTGGACTTTTTCACAAATTGTGGGAAACTT
CGTTTCTATTGCTGGGATACTGCTGGGCAAGAGAAATTTGGAGGTCTTCGAGATGGCTACTACATTCATGGGCAATGTGCAATTATAATG
TTTGATGTCACAGCACGGCTGACCTACAAGAATGTGCCAACATGGCATCGAGATCTCTGCAGGGTTTGTGAAAGTATTCCTATTGTCCTC
TGTGGAAACAAAGTTGATGTCAAGAATAGGCAGGTGAAGGCCAAGCAAGTTACATTCCACCGGAAGAAAAATTTGCAGTACTATGAGATT
TCTGCAAAGAGCAACTACAATTTTGAAAAGCCTTTCTTGTACCTTGCCAGGAAGCTTGCTGGGGATCCCAATCTTCATTTCGTGGAATCA
CCTGCCCTTCTTCCCCCAGAAGTCCAGATAGATTTGGCTGCACAGCAACAGCATGAGGCTGAGCTTGCTCAAGCAGCTATTCAACCACTC
CCTGACGACGACGACGATGCXGTTCGAGTAAATAXAGATGGGTCGTTTGCTGCTACTTCACAACCTACTACCTCXGCTCTTTTTGGTTGC
AAAGTTTATGAACTTCTAGATAGTAGTAGTTTATTGCGACGATTAGCGCAAGTAGGTTGTGATTTGGGCGTCGGCGGGCTGTCAGCTGTT
GGTACCCTTGTGTTGTGA
Edits in Original Sequence 
(5')XXCGGACTCTTCCCTCCTGCTCTACTGTATCATCTCACXGCTCTCAATCTCGATCTCCACCGTCCGTTAGCTCGTACTTGCAAAAT
GGCTTTGCCTAATCAGCAGATTGTGGATTACCCTAGCTTTAAGCTTGTGATTGTCGGTGATGGAGGAACTGGTAAAACTACTTTTGTCAA
GAGGCACTTGACTGGTGAATTTGAGAAAAAATATGAACCAACTATTGGAGTGGAGGTTCACCCATTGGACTTTTTCACAAATTGTGGGAA
ACTTCGTTTCTATTGCTGGGATACTGCTGGGCAAGAGAAATTTGGAGGTCTTCGAGATGGCTACTACATTCATGGGCAATGTGCAATTAT
AATGTTTGATGTCACAGCACGGCTGACCTACAAGAATGTGCCAACATGGCATCGAGATCTCTGCAGGGTTTGTGAAAGTATTCCTATTGT
CCTCTGTGGAAACAAAGTTGATGTCAAGAATAGGCAGGTGAAGGCCAAGCAAGTTACATTCCACCGGAAGAAAAATTTGCAGTACTATGA
GATTTCTGCAAAGAGCAACTACAATTTTGAAAAGCCTTTCTTGTACCTTGCCAGGAAGCTTGCTGGGGATCCCAATCTTCATTTCGTGGA
ATCACCTGCCCTTCTTCCCCCAGAAGTCCAGATAGATTTGGCTGCACAGCAACAGCATGAGGCTGAGCTTGCTCAAGCAGCTATTCAACC
ACTCCCTGACGACGACGACGATGCXGTTCGAGTAAATAXAGATGGGTCGTTTGCTGCTACTTCACAACCTACTACCTCXGCTCTTTTTGG
TTGCAAAGTTTATGAACTTCTAGATAGTAGTAGTTTATTGCGACGATTAGCGCtAAGTAGGTTGTGATTTcGGGCGTCGGCGGGCTGTCA
GCTGTTGGTACCCTTGTGTTGTGA(3')GTAGGTATTGTAACAACAGCCAATGGCCAAATAGCCAATAGTCGAGAGGTACTCCCAGAAAT
TTTTACTTTCTACTGTTTGATGTGATCTTGAACTTGTGAGCAGATGGAAAGTGGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan