ESTScan Details for Unigene SGN-U302586

Score 
157
Direction 
Forward
Predicted Peptide Sequence 
GKSSSRQSKPKCLLNPNINKXFESCGLTITKTTSLAVRPNXVHRGEEKGTENKWYRTTNINQMGIVEEAHNAKVLGSGEQTIVLAHGFGT
GSIGVEAPGATPSGGLQGYFVDKMGAGTTNPDYFDFERYATLEGYAYDVIAILEELRVDSCIYVGHSVSAMIGAVASIARPDLFTKLVMV
SGSPRYLNDVDYYGGFEQEDLDQLFEAMKSNYRAWCDGFAPLAVGGDMDSVAVQEFSRTLFNMRPDIALSVARTIFCSDTETFASPCEGA
LSHHPEHEG
Predicted Coding Sequence 
GGTAAGTCAAGTAGCAGACAATCAAAGCCCAAGTGCCTGCTTAATCCCAATATAAACAAGXTTTTCGAGTCTTGTGGACTGACCATCACA
AAAACTACCAGCCTTGCTGTTAGACCTAATXTAGTTCATCGCGGCGAGGAGAAGGGAACXGAGAATAAGTGGTACCGTACTACTAACATA
AATCAGATGGGGATAGTGGAGGAAGCTCACAACGCCAAGGTCTTAGGTTCTGGGGAGCAGACCATAGTGTTGGCGCATGGGTTCGGGACX
GGATCAATCGGTGTGGAAGCACCTGGTGCCACACCTAGTGGAGGATTACAGGGTTATTTTGTTGATAAGATGGGCGCCGGAACCACCAAT
CCGGACTACTTTGACTTCGAAAGATATGCTACTCTGGAGGGCTATGCCTATGATGTGATCGCAATACTGGAGGAGCTCCGGGTGGATTCC
TGCATATATGTTGGCCACTCCGTTTCGGCCATGATTGGCGCCGTCGCTTCTATTGCTCGCCCTGACCTCTTCACCAAACTCGTCATGGTT
TCTGGCTCACCTAGGTACCTTAACGACGTGGATTACTATGGAGGGTTCGAGCAGGAAGATCTGGACCAGTTGTTCGAAGCCATGAAGTCA
AATTACAGGGCATGGTGCGATGGATTTGCACCCTTGGCCGTTGGAGGAGACATGGACTCCGTTGCCGTGCAAGAATTCAGCAGGACACTA
TTCAACATGAGGCCTGACATAGCACTCAGCGTTGCTCGAACCATTTTCTGTAGTGACACXGAGACATTTGCTAGCCCATGTGAGGGTGCC
TTGTCGCATCATCCAGAGCATGAAGGX
Edits in Original Sequence 
(5')GGTAAGTCAAGTAGCAGACAATCAAAGCCCAAGTGCCTGCTTAATCCCAATATAAACAAGXTTTTCGAGTCTTGTGGACTGACCAT
CACAAAAACTAgCCAGCCTTGCTGTTAGACCTAATXTAGTTCATCGCGGCGAGGAGAAGGGAACXGAGAATAAGTGGTACCGTACTACTA
ACATAAATCAGATGGGGATAGTGGAGGAAGCTCACAACGCCAAGGTCTTAGGTTCTGGGGAGCAGACCATAGTGTTGGCGCATGGGTTCG
GGACXGGATCAATCGGTGTGGAAGCACCTGGTGCCACACCTAGTGGAGGATTACAGGGTTATTTTGTTcGATAAGATGGGCGCCGGAACC
ACCAATCCGGACTACTTTGACTTCGAAAGATATGCTACTCTGGAGGGCTATGCCTATGATGTGATCGCAATACTGGAGGAGCTCCGGGTG
GATTCCTGCATATATGTTGGCCACTCCGTTTCGGCCATGATTGGCGCCGTCGCTTCTATTGCTCGCCCTGACCTCTTCACCAAACTCGTC
ATGGTTTCTGGCTCACCTAGGTACCTTAACGACGTGGATTACTATGGAGGGTTCGAGCAGGAAGATCTGGACCAGTTGTTCGAAGCCATG
AAGTCAAATTACAGGGCATGGTGCGATGGATTTGCACCCTTGGCCGTTGGAGGAGACATGGACTCCGTTGCCGTGCAAGAATTCAGCAGG
ACACTATTCAACATGAGGCCTGACATAGCACTCAGCGTTGCTCGAACCATTTTCTGTAGTGACACXGAGACATTTGCTAGCCCATGTGAG
GGTGCCTTGTCGCATCATCCAGAGCATGAAGGX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan