ESTScan Details for Unigene SGN-U302615

Score 
251
Direction 
Forward
Predicted Peptide Sequence 
RARLRXEAPENYVRGSDPRAVNTTDSKAGALAISTFWDTPIYDVPWVERLRYNIIQVYTAFLQLQSLPRLRSSQLALTSADSSFTCRLTT
PATSQCSDFRTPPILGEVIWCNRLGQWEKNTEKIRFKPMVKETEYYDVLGVSPAATEAEIKKAYYIKARQVHPDKNPNDPQAAQNFQVLG
EAYQVLSDPAQRQAYDNYGKSGISTEAIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGEDFDAKKLQEX
Predicted Coding Sequence 
AGGGCCCGCCTGCGTXCTGAAGCACCCGAGAACTATGTGAGGGGGTCCGACCCACGGGCAGTCAACACAACGGATTCAAAGGCAGGGGCG
CTTGCAATCTCCACCTTCTGGGATACTCCCATTTATGACGTGCCATGGGTTGAGAGATTGAGATATAACATCATCCAAGTTTATACCGCG
TTTCTGCAACTTCAGTCTCTTCCGCGTCTTCGATCAAGCCAGCTTGCTCTCACTTCAGCTGATAGTTCATTCACCTGCCGTTTGACGACG
CCAGCAACTTCTCAGTGTTCTGATTTCCGTACCCCACCCATCCTAGGAGAAGTGATTTGGTGTAATCGGCTAGGTCAATGGGAGAAGAAC
ACAGAAAAAATTCGCTTCAAGCCGATGGTGAAGGAGACGGAATACTACGACGTTTTGGGGGTTAGCCCAGCCGCAACTGAAGCTGAAATT
AAGAAAGCTTATTACATTAAGGCACGACAGGTTCATCCCGATAAAAATCCAAATGACCCTCAAGCAGCCCAAAATTTCCAGGTTTTGGGA
GAGGCTTACCAAGTGCTGAGTGATCCTGCCCAACGACAGGCTTACGATAATTATGGGAAATCAGGAATTTCAACTGAAGCTATAATTGAT
CCTGCAGCAATATTTGCCATGCTTTTCGGAAGTGAGCTTTTTGAAGAATACATTGGTCAGCTCGCCATGGCATCAATGGCTTCATTGGAT
ATTTTCACCGAAGGTGAAGATTTTGATGCTAAAAAGCTGCAAGAAAAX
Edits in Original Sequence 
CGAATAATTTGAGTAAGAAAGGCACGCCCTTCTAGCATTTTTGCATTTTTTTTTTAATCATA(5')AGGGCCCGCCTGCGTXCTGAAGCA
CCCGAGAACTATGTGAGGGGGTCCGACCCACGGGCAGTCAACACAACGGATTCAAAGGtCAGGGGCGCTTGCAATCTCCACCTTCTGGGA
TACTCCCATTTATGACGTGCCATGGcGTTGAGAGATTGAGATATAACATCATCCAAGTTTATACCGCGTTTCTGCAACTTCAGTCTCTTC
CGCGTCTTCGATCAAGCCAGCTTaGCTCTCACTTCAGCTGATAGTTCATTCACCTGCCGTTTGACGACGCCAGCAACTTCTCAGTGTTCT
GATTTCCGTACCCCACCCATCCTAGGAGAAGTGATTTGGTGTAATCGGCTAGGTCAATcGGGAGAAGAACACAGAAAAAATTCGCTTCAA
GCCGATGGTGAAGGAGACGGAATACTACGACGTTTTGGGGGTTAGCCCAGCCGCAACTGAAGCTGAAATTAAGAAAGCTTATTACATTAA
GGCACGACAGGTTCATCCCGATAAAAATCCAAATGACCCTCAAGCAGCCCAAAATTTCCAGGTTTTGGGAGAGGCTTACCAAGTGCTGAG
TGATCCTGCCCAACGACAGGCTTACGATAATTATGGGAAATCAGGAATTTCAACTGAAGCTATAATTGATCCTGCAGCAATATTTGCCAT
GCTTTTCGGAAGTGAGCTTTTTGAAGAATACATTGGTCAGCTCGCCATGGCATCAATGGCTTCATTGGATATTTTCACCGAAGGTGAAGA
TTTTGATGCTAAAAAGCTGCAAGAAAAX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan