Notice: The contact form functionality has been restored. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U302642

Score 
218
Direction 
Forward
Predicted Peptide Sequence 
RKSFKDSLKVLEADIQHANTLASDFPREYDGALPADENVLQSSSTPVPFPGSVADCHLAGALGLLRILIYKVYVDGTTTMSTHERKASIR
EFYAXYLSLINATPEGGNRFRRQKAKSSXAWKDIKEEMKRNTGKFXELEVEREEECGICMEMNSKIVLPNCNHAMCMKCYREWRLRSQSC
PFCRDSLKRVNSGDLWVLMDSKDVVDMATITRENLRRLFMYIDKLPLVVPDNLFDTYDNXFKVGKRVLSERSPEXAAVSLGVLNPI
Predicted Coding Sequence 
XXGCGGAAGTCCTTTAAGGATTCTCTCAAAGTTCTTGAAGCTGATATTCAGCATGCCAATACTCTGGCTTCGGATTTTCCACGGGAGTAT
GATGGTGCXTTGCCTGCAGATGAGAATGTCCTACAGTCCAGCAGCACACCTGTTCCTTTTCCTGGTTCAGTGGCTGACTGTCACCTAGCT
GGTGCTCTTGGCCTGTTAAGAATCTTGATTTATAAGGTTTACGTCGATGGCACCACAACAATGTCCACTCATGAAAGGAAAGCAAGCATT
AGAGAATTCTATGCTXATTATCTATCCCTCATTAATGCAACTCCAGAGGGGGGTAACCGATTCAGAAGACAAAAAGCAAAAAGCAGTGXT
GCTTGGAAAGATATAAAAGAAGAGATGAAGAGGAACACCGGCAAATTTXCGGAGCTAGAAGTTGAAAGGGAGGAAGAATGTGGTATTTGC
ATGGAGATGAACAGCAAAATAGTCTTGCCCAACTGCAACCATGCCATGTGCATGAAATGCTACCGTGAATGGCGTTTAAGGTCACAATCG
TGCCCCTTCTGCCGTGATAGCCTGAAGAGGGTCAACTCAGGTGATCTCTGGGTGCTTATGGACAGCAAGGATGTCGTGGACATGGCTACC
ATAACAAGGGAGAATCTGAGAAGGCTCTTTATGTATATAGATAAGTTGCCTCTTGTTGTTCCGGATAACCTTTTTGACACTTACGATAAT
XCATTTAAGGTAGGCAAAAGGGTTTTGTCTGAGCGGTCTCCTGAAGXTGCTGCTGTGTCTCTGGGTGTTCTAAACCCTATA
Edits in Original Sequence 
(5')XXGCGGAAGTCCTTTAAGGATTCTCTCAAAGTTCTTGAAGCTGATATTCAGCATGCCAATACTCTGGCTTCGGATTTTCCACGGGA
GTATGATGGTGCXTTGCCTGCAGATGAGAATGTCCTACAGTCCAGCAGCACACCTGTTCCTTTTCCTGGTTCAGTGGaCTGACTGTCACC
TAGCTGGTGCTCTTGGCCTGTTAAGAATCTTGATTTATAAGGTTTACGTCGATGGCACCACAACAATGTCCACTCATGAAAGGAAAGCAA
GCATTAGAGAATTCTATGCTXATTATCTATCCCTCATTAATGCAACTCCAGAGGGGGGTAACCGATTCAGAAGACAAAAAGCAAAAAGCA
GTGXTGCTTGGAAAGATATAAAAGAAGAGATGAAGAGGAACACCGGCAAATTTXCGGAGCTAGAAGTTGAAAGGGAGGAAGAATGTGGTA
TTTGCATGGAGATGAACAGCAAAATAGTCTTGCCCAACTGCAACCATGCCATGTGCATGAAATGCTACCGTGAATGGCGTTTAAGGTCAC
AATCGTGCCCCTTCTGCCGTGATAGCCTGAAGAGGGTCAACTCAGGTGATCTCTGGGTGCTTATGGACAGCAAGGATGTCGTGGACATGG
CTACCATAACAAGGGAGAATCTGAGAAGGCTCTTTATGTATATAGATAAGTTGCCTCTTGTTGTTCCGGATAACCTTTTTGACACTTACG
ATAATXCATTTAAGGTAGGCAAAAGGGTTTTGTCTGAGCGGTCTCCTGAAGXTGCTGCTGTGTCTCTGGGTGTTCTAAACCCTATA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan