ESTScan Details for Unigene SGN-U302669

Score 
417
Direction 
Forward
Predicted Peptide Sequence 
VKEIFASAFAGRTFESSLVDLLIKNGRNGKSNRKGYYIYQKGSKAKPDPSVLPIIDESRKLANVMPGGKPISVTDQEVVEMILFPVVNES
CRVLDEGIVIRASDLDVASVLGMSFPTYRGGIVFWADTIGADYIYKKLKKWSEAYGNFYXAIKVFGRKSIERNTTECTDLNVFSFKVTPL
GKVVSADAKALACKELQKTSTVWXGKWEQIPDAMYLDXVIKIX
Predicted Coding Sequence 
XCTGTTAAGGAAATATTTGCATCTGCTTTTGCTGGTCGCACATTTGAATCTTCTCTAGTAGATCTTCTAATAAAAAATGGGCGAAATGGT
AAAAGTAATAGGAAAGGGTACTATATATATCAAAAGGGAAGCAAGGCAAAACCTGATCCATCAGTTCTACCAATTATTGACGAATCTAGG
AAGCTTGCCAATGTGATGCCTGGAGGAAAGCCTATATCTGTCACTGACCAAGAAGTTGTTGAGATGATTCTCTTTCCCGTGGTAAACGAG
TCATGCCGTGTTCTGGATGAAGGAATTGTGATACGAGCATCAGACCTAGATGTTGCATCTGTTCTTGGAATGAGTTTCCCCACTTACCGT
GGTGGTATTGTATTCTGGGCGGATACAATTGGGGCTGACTACATATATAAAAAGCTCAAAAAATGGTCAGAAGCTTATGGTAACTTCTAT
AXAGCCATCAAGGTTTTTGGAAGAAAGAGCATTGAGAGGAATACCACTGAGTGCACCGACCTCAACGTCTTCAGCTTCAAAGTCACGCCT
CTAGGCAAAGTGGTATCTGCAGACGCCAAAGCTTTAGCATGTAAAGAGTTGCAGAAAACAAGCACTGTTTGGCXGGGCAAATGGGAACAA
ATTCCCGATGCAATGTACCTCGATGXTGTCATAAAAATTGXX
Edits in Original Sequence 
(5')XCTGTTAAGGAAATATTTGCATCTGCTTTTGCTGGTCGCACATTTGAATCTTCTCTAGTAGATCTTCTAATAAAAAATGGGCGAAA
TGGTAAAAGTAATAGGAAAGGGTACTATATATATCAAAAGGGAAGCAAGGCAAAACCTGATCCATCAGTTCTACCAATTATTGACGAATC
TAGGAAGCTTGCCAATGTGATGCCTGGAGGAAAGCCTATATCTGTCACTGACCAAGAAGTTGTTGAGATGATTCTCTTTCCCGTGGTAAA
CGAGTCATGCCGTGTTCTGGATGAAGGAATTGTGATACGAGCATCAGACCTAGATGTTGCATCTGTTCTTGGAATGAGTTTCCCCACTTA
CCGTGGTGGTATTGTATTCTGGGCGGATACAATTGGGGCTGACTACATATATAAAAAGCTCAAAAAATGGTCAGAAGCTTATGGTAACTT
CTATAXAGCCATCAAGGTTTTTGGAAGAAAGAGCATTGAGAGGAATACCACTGAGTGCACCGACCTCAACGTCTTCAGCTTCAAAGTCAC
GCCTCTAGGCAAAGTGGTATCTGCAGACGCCAAAGCTTTAGCATGTAAAGAGTTGCAGAAAACAAGCACTGTTTGGCXGGGCAAATGGGA
ACAAATTCCCGATGCAATGTACCTCGATGXTGTCATAAAAATTGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan