ESTScan Details for Unigene SGN-U302798

Score 
440
Direction 
Forward
Predicted Peptide Sequence 
QGEARPSPXPDSDDFFNQQVPDFDPVPVIDSECINQKKLDEACREWGMFRLINHGIPLTLLNKLHDHAKKLFSLAYESKQASFTPPISYF
WGTPGLTPSGVVIQRDARAQSQNFNWLEGFHVLLTPLSQLQYEDPXARLFQVLAGRIREAPARLATTIFEALAKNLQLDSERTRAYLSTA
TGHLRVHRYPCCFEAEQLRAWGIDVHTDSSVLSILHEDEVGGLQVCSNNQWFDVKPQFDSLIVNLGDMMQAMSDDNYIGAKHRVKVNKHK
ERISVGYFVLPYEDTVIESSKYKPFTYADFRAEVQRDLKTVGYKIGLQKFKLRRRFSLRAHSGSASQNQSX
Predicted Coding Sequence 
CAAGGAGAAGCCCGACCCTCCCCAGXCCCCGATTCTGACGACTTCTTCAACCAACAAGTTCCAGATTTCGACCCCGTTCCTGTGATAGAT
TCCGAGTGCATAAACCAGAAGAAGCTGGATGAAGCTTGTAGAGAGTGGGGTATGTTTCGGTTGATCAACCACGGGATTCCTCTGACCCTT
TTGAACAAACTTCATGACCACGCCAAAAAGCTCTTTTCTCTCGCCTATGAATCCAAGCAAGCCTCTTTCACCCCTCCCATATCCTACTTT
TGGGGCACCCCTGGCCTCACCCCATCTGGTGTTGTCATACAAAGAGATGCTCGTGCCCAGAGCCAGAACTTCAACTGGCTCGAAGGTTTT
CATGTTCTTTTAACTCCATTATCCCAGCTTCAATATGAAGATCCTXATGCTCGACTCTTTCAGGTGCTTGCTGGAAGAATACGGGAGGCA
CCAGCTAGGCTGGCTACGACAATTTTCGAGGCTCTGGCAAAGAATCTCCAATTGGATTCTGAACGTACAAGAGCTTATCTGTCGACAGCA
ACGGGACACCTACGAGTTCATCGCTACCCATGCTGCTTCGAGGCAGAGCAGTTGCGAGCATGGGGCATAGATGTCCACACTGACAGTTCT
GTACTTTCCATTCTGCACGAAGATGAAGTCGGTGGACTTCAAGTCTGCTCCAATAATCAGTGGTTCGACGTCAAGCCTCAATTCGATTCC
CTGATTGTGAACCTCGGCGACATGATGCAGGCCATGAGCGATGACAATTATATTGGTGCCAAGCACAGAGTGAAGGTGAACAAGCACAAG
GAAAGAATCTCGGTGGGCTATTTTGTGCTCCCATACGAAGACACCGTTATCGAAAGCTCCAAGTACAAGCCCTTCACTTATGCTGATTTT
CGAGCTGAAGTGCAACGAGATTTGAAGACCGTCGGATACAAGATCGGCCTCCAGAAGTTCAAGCTCAGGAGACGTTTTAGTCTTAGAGCA
CATTCTGGAAGTGCCAGTCAAAATCAATCTTXX
Edits in Original Sequence 
(5')CAAGGAGAAGCCCGACCCTCCCCAGXCCCCGATTCTGACGACTTCTTCAACCAACAAGTTCCAGATTTCGACCCCGTTCCTGTGAT
AGATTCCGAGTGCATAAACCAGAAGAAGCTGGATGAAGCTTGTAGAGAGTGGGGTATGTTTCGGTTGATCAACCACGGGATTCCTCTGAC
CCTTTTGAACAAACTTCATGACCACGCCAAAAAGCTCTTTTCTCTCGCCTATGAATCCAAGCAAGCCTCTTTCACCCCTCCCATATCCTA
CTTTTGGGGCACCCCTGGCCTCACCCCATCTGGTGTTGTCATACAAAGAGATGCTCGTGCCCAGAGCCAGAACTTCAACTGGCTCGAAGG
TTTTCATGTTCTTTTAACTCCATTATCCCAGCTTCAATATGAAGATCCTXATGCTCGACTCTTTCAGGTGCTTGCTGGAAGAATACGGGA
GGCACCAGaCTAGGCTGGCTACGACAATTTTCGAGGCTCTGGCAAAGAATCTCCAATTGGATTCTGAACGTACAAGAGCTTATCTGTCGA
CAGCAACGGGACACCTACGAGTTCATCGCTACCCATGCTGCTTCGAGGCAGAGCAGTTGCGAGCATGGGGCATAGATGTCCACACTGACA
GTTCTGTACTTTCCATTCTGCACGAAGATGAAGTCGGTGGACTTCAAGTCTGCTCCAATAATCAGTGGTTCGACGTCAAGCCTCAATTCG
ATTCCCTGATTGTGAACCTCGGCGACATGATGCAGGCCATGAGCGATGACAATTATATTGGTGCCAAGCACAGAGTGAAGGTGAACAAGC
ACAAGGAAAGAATCTCGGTGGGCTATTTTGTGCTCCCATACGAAGACACCGTTATCGAAAGCTCCAAGTACAAGCCCTTCACTTATGCTG
ATTTTCGAGCTGAAGTGCAACGAGATTTGAAGACCGTCGGATACAAGATCGGCCTCCAGAAGTTCAAGCTCAGcGAGACGTTTTAGTCTT
AGAGCACATTCTGGAAGTGCCAGTCAAAATCAATCTTXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan