ESTScan Details for Unigene SGN-U302866

Score 
810
Direction 
Forward
Predicted Peptide Sequence 
HFGGLKARRSPRSSTLIRTTAALPIXLNSPKQNHQQQQPRRGLVLVVAAAAGPVAVSNAQTRERMKLKEIFEDAYDRCRTAPMEGVAFTL
ENFHAALDKFDFDSEIGSRVKGTVFAVDANGALVDITAKSSAYLPVSQASIYRIKSVEEAGIVPGLCEEFEVIGEIEADDSLILSLRAIQ
YELAWERCRQLQAEDVVVKGKVTGANKGGVVALVEGLVGFVPFSQISTKSTAEELLEKELPLKFVEVDEEQSRLILSNRKAMADSQAQLG
IGSVVLGTVQSLKPYGAFIDIGGINGLLHVSQNSHDRVSDIATVLQPGDTLKVMILSHDRESSRXESVYKX
Predicted Coding Sequence 
XXACATTTTGGTGGGCTGAAAGCCCGCCGCTCTCCACGATCCTCAACACTAATTCGAACAACCGCTGCTCTACCCATTGXTCTCAACTCA
CCCAAACAGAACCACCAGCAGCAGCAGCCCAGAAGAGGACTAGTACTAGTTGTGGCAGCAGCTGCCGGACCAGTGGCTGTCTCCAACGCA
CAGACCAGAGAGCGGATGAAGCTCAAAGAAATTTTTGAAGACGCCTACGACAGGTGCCGCACTGCCCCTATGGAAGGTGTCGCCTTTACG
CTCGAAAACTTCCACGCTGCCCTTGATAAGTTCGACTTCGATTCTGAAATTGGTAGCAGGGTCAAAGGAACAGTTTTTGCTGTAGATGCA
AATGGAGCCCTTGTTGACATTACTGCAAAATCATCAGCCTACTTGCCTGTGAGCCAGGCATCAATTTACAGGATAAAGAGTGTAGAAGAA
GCTGGCATAGTGCCTGGTCTTTGTGAGGAATTTGAAGTCATTGGTGAGATTGAAGCTGATGACAGTTTGATACTGAGCCTGCGTGCTATC
CAGTACGAGCTAGCATGGGAAAGATGTAGACAGCTTCAAGCTGAAGATGTTGTTGTCAAGGGTAAGGTAACTGGTGCGAATAAAGGTGGA
GTAGTGGCATTGGTTGAAGGCCTTGTTGGGTTTGTTCCCTTCTCGCAAATATCAACGAAATCAACTGCAGAGGAGCTTCTTGAGAAGGAG
CTTCCACTTAAGTTTGTAGAGGTTGATGAAGAACAGTCGAGGCTCATCCTCAGCAATCGTAAGGCCATGGCTGACAGTCAAGCGCAGCTT
GGAATTGGCTCTGTGGTTCTTGGAACTGTTCAGAGCTTGAAACCTTATGGTGCTTTTATTGACATAGGCGGGATCAATGGCCTTCTACAT
GTCAGTCAGAATAGTCACGATCGAGTCTCGGACATTGCAACAGTCCTTCAGCCTGGTGACACTCTAAAGGTGATGATACTAAGCCATGAT
CGCGAGAGTAGCAGAGXTGAGTCTGTCTACAAAGXX
Edits in Original Sequence 
(5')XXACATTTTGGTGGGCTGAAAcGCCCGCCGCTCTCCACGATCCTCAACACTAATTCGAACAACCGCTGCTCTACCCATTGXTCTCA
ACTCACCCAAACAGAACCACCAGCAGCAGCAGCCCAGAAGAGGACTAGTACTAGTTGTGGCAGCAGCTGCCGGACCAGTGGCTGTCTCCA
ACGCACAGACCAGAGAGCGGATGAAGCTCAAAGAAATTTTTGAAGACGCCTACGACAGGTGCCGCACTGCCCCTATGGAAGGTGTCGCCT
TTACGCTCGAAAACTTCCACGCTGCCCTTGATAAGTTCGACTTCGATTCTGAAATTGGTAGCAGGGTCAAAGGAACAGTTTTTGCTGTAG
ATGCAAATGGAGCCCTTGTTGACATTACTGCAAAATCATCAGCCTACTTGCCTGTGAGCCAGGCATCAATTTACAGGATAAAGAGTGTAG
AAGAAGCTGGCATAGTGCCTGGTCTTTGTGAGGAATTTGAAGTCATTGGTGAGATTGAAGCTGATGACAGTTTGATACTGAGCCTGCGTG
CTATCCAGTACGAGCTAGCATGGGAAAGATGTAGACAGCTTCAAGCTGAAGATGTTGTTGTCAAGGGTAAGGTAACTGGTGCGAATAAAG
GTGGAGTAGTGGCATTGGTTGAAGGCCTTGTTGGGTTTGTTCCCTTCTCGCAAATATCAACGAAATCAACTGCAGAGGAGCTTCTTGAGA
AGGAGCTTCCACTTAAGTTTGTAGAGGTTGATGAAGAACAGTCGAGGCTCATCCTCAGCAATCGTAAGGCCATGGCTGACAGTCAAGCGC
AGCTTGGAATTGGCTCTGTGGTTCTTGGAACTGTTCAGAGCTTGAAACCTTATGGTGCTTTTATTGACATAGGCGGGATCAATGGCCTTC
TACATGTCAGTCAGAATAGTCACGATCGAGTCTCGGACATTGCAACAGTCCTTCAGCCTGGTGACACTCTAAAGGTGATGATACTAAGCC
ATGATCGCGAGAGTAGCAGAGXTGAGTCTGTCTACAAAGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan