ESTScan Details for Unigene SGN-U302874

Score 
746
Direction 
Forward
Predicted Peptide Sequence 
KDVFLPWYNAYRFLVPNAKRLEVEGLAPFAPMDQCTLQNSSNALDQWINSATLSLVHFVRKEMGAYRLYTVVPELLKFLDNLTNIYVRFN
RKRLKGRTGELDCRVALSTLYHVLLTSCKAMAPFTPFFTEVLYQNMRKVCNGSEESIHYCSFPEVEGEGGERIEKSVSRMMTIIDLARNI
RERHNKPLKTPLREMVVVHPDAEFLGDIAGKLKEYVLEELNIKSLVPCNDTLKYASLRAEPDFSVLGKRLGKSMGVVAKEVKAMSTDDIL
AFEKAGEINIATFSLKLSDIKISRGFRRPDXISDKDMDAAGDGDVLVVLDFVRTNSLFEX
Predicted Coding Sequence 
XTTAAAGATGTCTTTTTGCCATGGTATAATGCTTACAGATTCCTTGTACCAAATGCAAAAAGGCTTGAGGTTGAGGGTCTTGCACCATTT
GCTCCAATGGATCAATGTACTCTCCAGAATTCTTCTAATGCTCTTGATCAGTGGATCAACTCGGCAACTCTGAGTTTGGTACATTTTGTA
CGGAAAGAAATGGGTGCTTATAGACTGTATACGGTTGTTCCTGAACTCCTGAAATTTCTGGATAACCTGACAAACATCTATGTGCGGTTC
AATCGGAAGAGACTGAAAGGTCGTACAGGTGAATTGGATTGCAGAGTTGCATTATCAACTCTTTACCATGTTCTGCTAACTTCATGTAAA
GCAATGGCTCCATTTACACCATTTTTCACGGAGGTTCTTTATCAGAATATGCGAAAAGTTTGCAATGGATCAGAAGAAAGCATTCATTAT
TGTAGTTTTCCAGAGGTTGAAGGGGAGGGAGGAGAACGCATTGAAAAAAGTGTTAGCAGGATGATGACTATCATTGATCTTGCACGCAAC
ATTCGTGAACGTCATAACAAACCTCTCAAGACACCACTCAGGGAGATGGTGGTGGTGCACCCTGATGCAGAGTTCCTTGGTGACATTGCT
GGCAAACTAAAAGAGTATGTGCTTGAGGAACTCAACATCAAGTCATTGGTCCCTTGTAATGATACTTTGAAGTATGCTTCTTTACGTGCA
GAACCTGATTTTAGTGTATTAGGGAAAAGGCTTGGAAAGTCAATGGGAGTTGTTGCAAAAGAGGTTAAGGCCATGTCCACGGATGATATA
TTGGCTTTTGAAAAGGCTGGAGAAATAAATATTGCTACTTTCTCTCTAAAGCTTAGTGATATTAAGATCTCTCGTGGTTTCAGACGTCCT
GACNATATTAGTGATAAGGACATGGATGCCGCAGGAGATGGTGATGTTTTGGTGGTGTTGGATTTCGTCAGGACGAATTCACTGTTTGAA
GXX
Edits in Original Sequence 
(5')XTTAAAGATGTCTTTTTGCCATGGTATAATGCTTACAGATTCCTTGTACCAAATGCAAAAAGGCTTGAGGTTGAGGGTCTTGCACC
ATTTGCTCCAATGGATCAATGTACTCTCCAGAATTCTTCTAATGCTCTTGATCAGTGGATCAACTCGGCAACTCTGAGTTTGGTACATTT
TGTACGGAAAGAAATGGGTGCTTATAGACTGTATACGGTTGTTCCTGAACTCCTGAAATTTCTGGATAACCTGACAAACATCTATGTGCG
GTTCAATCGGAAGAGACTGAAAGGTCGTACAGGTGAATTGGATTGCAGAGTTGCATTATCAACTCTTTACCATGTTCTGCTAACTTCATG
TAAAGCAATGGCTCCATTTACACCATTTTTCACGGAGGTTCTTTATCAGAATATGCGAAAAGTTTGCAATGGATCAGAAGAAAGCATTCA
TTATTGTAGTTTTCCAGAGGTTGAAGGGGAGGGAGGAGAACGCATTGAAAAAAGTGTTAGCAGGATGATGACTATCATTGATCTTGCACG
CAACATTCGTGAACGTCATAACAAACCTCTCAAGACACCACTCAGGGAGATGGTGGTGGTGCACCCTGATGCAGAGTTCCTTGGTGACAT
TGCTGGCAAACTAAAAGAGTATGTGCTTGAGGAACTCAACATCAAGTCATTGGTCCCTTGTAATGATACTTTGAAGTATGCTTCTTTACG
TGCAGAACCTGATTTTAGTGTATTAGGGAAAAGGCTTGGAAAGTCAATGGGAGTTGTTGCAAAAGAGGTTAAGGCCATGTCCACGGATGA
TATATTGGCTTTTGAAAAGGCTGGAGAAATAAATATTGCTACTTTCTCTCTAAAGCTTAGTGATATTAAGATCTCTCGTGGTTTCAGACG
TCCTGACNATATTAGTGATAAGGACATGGATGCCGCAGGAGATGGTGATGTTTTGGTGGTGTTGGATTTaCGTCAGGACGAATTCACTGT
TTGAAGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan