ESTScan Details for Unigene SGN-U302957

Score 
-78
Direction 
Forward
Predicted Peptide Sequence 
AMEGPVIPERVREAGSTSAESESAAHRARFTWYSTLGVTSTGSSVPLAATVISKPDPIFQPASSSSFSRLTCEAQQCKSLDESECRNNTC
LYQVSYGDGSYTVGDFVTETITFGGSAAVNNIAIGCGHNNEGLFVGAAGLIGLGGGPLSFPSQIKAKSFSYCLVDRDSDASSTLDFDSVV
PADAVTAPLLQNPKLDTFYYLDLTGISVAGELLPVPPSNFKLADNGEGGVIIDSGTAVTRLPTETYNALRDAFVKGTKNLPSANGVALFD
TCFALGSRKSVEVPTVSFHFSNGKDLSLPAKNYLIPVDSTGTFCFAFAPTSSTLSIIGNVQQQGTRVSYDIAHSLIAFSSNNAXKMKTEV
TGLQFFLDGFFTAYLSNRWPDPDIVX
Predicted Coding Sequence 
GCCATGGAAGGGCCTGTAATTCCGGAACGAGTCAGGGAAGCGGGGAGTACTTCAGCCGAGTCGGAATCGGCCGCCCACCGAGCCAGGTTT
ACATGGTACTCGACTCTGGGAGTGACGTCAACTGGGTCCAGTGTGCCCCTTGCAGCGACTGTTATCAGCAAGCCXGACCCAATTTTCCAG
CCGGCTTCCTCCTCTTCTTTCTCTCGTCTAACGTGCGAAGCTCAACAATGCAAATCTCTCGACGAGTCCGAATGTCGGAATAACACGTGT
CTCTACCAGGTGTCTTACGGAGATGGGTCCTACACCGTCGGCGATTTCGTAACGGAGACTATTACTTTCGGCGGCTCGGCAGCGGTTAAC
AACATAGCCATCGGCTGTGGCCACAATAACGAAGGCTTATTTGTCGGCGCTGCAGGATTAATCGGCTTAGGCGGCGGCCCGTTGTCTTTT
CCTTCCCAAATCAAAGCGAAGTCGTTTTCGTACTGCCTCGTGGACCGCGATTCTGACGCCAGTTCCACTCTCGATTTTGACTCCGTTGTC
CCCGCTGACGCCGTCACCGCGCCGTTGCTGCAAAATCCGAAGCTCGATACCTTTTACTACCTGGACTTGACGGGGATTAGCGTGGCCGGA
GAGTTACTTCCGGTTCCTCCGTCAAATTTTAAGTTAGCCGACAACGGCGAGGGTGGGGTCATCATTGATTCCGGAACGGCGGTGACGAGG
CTTCCAACGGAGACTTATAATGCTCTGCGTGATGCCTTTGTTAAGGGCACGAAAAACTTGCCGTCAGCTAACGGAGTAGCTCTATTTGAC
ACGTGTTTCGCTTTGGGTTCGAGGAAGAGCGTGGAGGTTCCAACGGTGTCGTTTCATTTTTCCAACGGGAAGGACCTGTCTTTACCGGCT
AAGAATTACTTGATCCCGGTGGATTCAACTGGGACGTTTTGCTTTGCATTTGCTCCAACGTCGTCTACGCTTTCCATCATCGGAAATGTG
CAGCAGCAAGGAACACGTGTCAGTTACGACATTGCCCATTCTCTCATTGCATTTTCATCCAACAATGCTGAXAAAATGAAGACTGAAGTT
ACTGGTTTACAGTTTTTTCTAGATGGGTTTTTTACTGCCTATTTAAGTAATAGATGGCCCGACCCTGATATTGTAAXX
Edits in Original Sequence 
(5')GCCATGGAAGGGCCTGTAATaTCCGGAACGAGTCAGGGAAGCGGGGAGTACTTCAGCCGAGTCGGAATCGGCCGCCCACCGAGCCA
GGTTTACATGGTACTCGACTCTGGGAGTGACGTCAACTGGGTCCAGTGTGCCCCTTGCAGCGACTGTTATCAGCAAGCCXGACCCAATTT
TCCAGCCGGCTTCCTCCTCTTCTTTCTCTCGTCTAACGTGCGAAGCTCAACAATGCAAATCTCTCGACGAGTCCGAATGTCGGAATAACA
CGTGTCTCTACCAGGTGTCTTACGGAGATGGGTCCTACACCGTCGGCGATTTCGTAACGGAGACTATTACTTTCGGCGGCTCGGCAGCGG
TTAACAACATAGCCATCGGCTGTGGCCACAATAACGAAGGCTTATTTGTCGGCGCTGCAGGATTAATCGGCTTAGGCGGCGGCCCGTTGT
CTTTTCCTTCCCAAATCAAAGCGAAGTCGTTTTCGTACTGCCTCGTGGACCGCGATTCTGACGCCAGTTCCACTCTCGATTTTGACTCCG
TTGTCCCCGCTGACGCCGTCACCGCGCCGTTGCTGCAAAATCCGAAGCTCGATACCTTTTACTACCTGGACTTGACGGGGATTAGCGTGG
CCGGAGAGTTACTTCCGGTTCCTCCGTCAAATTTTAAGTTAGCCGACAACGGCGAGGGTGGGGTCATCATTGATTCCGGAACGGCGGTGA
CGAGGCTTCCAACGGAGACTTATAATGCTCTGCGTGATGCCTTTGTTAAGGGCACGAAAAACTTGCCGTCAGCTAACGGAGTAGCTCTAT
TTGACACGTGTTTCGCTTTGGGTTCGAGGAAGAGCGTGGAGGTTCCAACGGTGTCGTTTCATTTTTCCAACGGGAAGGACCTGTCTTTAC
CGGCTAAGAATTACTTGATCCCGGTGGATTCAACTGGGACGTTTTGCTTTGCATTTGCTCCAACGTCGTCTACGCTTTCCATCATCGGAA
ATGTGCAGCAGCAAGGAACACGTGTCAGTTACGACATTGCCCATTCTCTCATTGCATTTTCATCCAACAATGCTGAXAAAATGAAGACTG
AAGTTACTGGtTTTACAGTTTTTTCTAGATGGGTTTTTTACTGCCTATTTAAGTAATAGATGGCCCGACCCTGATATTGTAAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan