ESTScan Details for Unigene SGN-U303031

Score 
58
Direction 
Forward
Predicted Peptide Sequence 
PTEFRLSVVGXVIFYVLVLKHKPNSLITAGYVRKITARKDIDVMEDLDNGAPDMAHQYSLDPYYIAHYLKGSIPHYFRILRKFYVFQAFD
SHLALCRYSNERFDGXIDKDALSRKVLFLGFFFPAQKKSRIYSFPINIKLPSVSSLHVHLLENPAVTGKLVRNKVIXALSPPYLRSIGIY
AFLLGDIKFDNCFVIIFDVKTRDLKCLEFEKPVVXGRLLTAAEICQKLVFGFPVWPPEKKFFAEAISSFSKDGHNSSKLPAYQQSLEETK
QVFDKYDANKDGKISPEEYKAILKALGKGNPLTVEVKKIFEVADLDGDGFIDFKEFVEVQKKEGGLKTADLQNAFRTFDMDGDGKITVEE
VFELLQKLGERCSMKDCRRM
Predicted Coding Sequence 
AAXCCTACTGAGTTTAGGCTATCAGTTGTAGGCGXGGTGATCTTTTATGTTTTGGTCCTCAAACACAAGCCTAACTCCTTGATAACTGCA
GGATATGTACGAAAGATAACTGCACGCAAGGACATTGATGTGATGGAGGACTTGGACAATGGAGCCCCTGACATGGCGCATCAATATAGT
CTAGACCCATATTACATTGCTCATTATTTAAAGGGTTCAATTCCTCATTACTTCAGGATTCTTAGAAAGTTTTATGTATTCCAAGCTTTT
GATAGTCATTTGGCGTTGTGTAGATATTCAAATGAGAGATTCGATGGCXCCATAGATAAGGATGCCTTGTCCAGAAAAGTGCTCTTTTTG
GGATTCTTTTTTCCAGCTCAGAAGAAATCAAGAATTTATTCTTTCCCTATTAACATAAAATTACCATCTGTTTCCTCTCTTCATGTCCAT
TTACTTGAGAATCCGGCCGTCACGGGCAAGTTGGTGAGGAATAAAGTTATTXCTGCCTTATCTCCTCCCTACTTAAGAAGCATAGGTATA
TATGCCTTTTTGCTTGGTGATATCAAATTCGATAACTGTTTCGTTATAATATTCGATGTGAAGACTCGAGACCTCAAGTGCTTGGAATTT
GAGAAGCCCGTTGTTGXTGGTCGGCTCCTAACAGCAGCTGAAATATGCCAAAAGTTAGTTTTTGGGTTTCCAGTATGGCCTCCCGAAAAG
AAATTTTTTGCGGAAGCCATCTCGTCGTTTTCCAAAGATGGGCATAATTCTAGTAAGTTACCCGCTTATCAGCAAAGCTTAGAGGAGACG
AAGCAGGTTTTCGACAAATATGACGCAAACAAAGATGGCAAGATTTCACCTGAGGAGTACAAGGCCATATTGAAAGCCCTGGGAAAGGGA
AATCCGCTTACAGTAGAAGTGAAAAAGATATTCGAGGTGGCAGATTTGGATGGTGATGGATTCATTGATTTCAAAGAGTTCGTGGAAGTG
CAGAAGAAAGAAGGCGGGTTAAAGACGGCGGACTTACAGAACGCTTTTCGGACATTCGACATGGATGGCGATGGAAAGATAACTGTGGAG
GAAGTTTTCGAGTTGTTGCAGAAACTTGGAGAGAGGTGCAGCATGAAGGATTGTAGAAGAATG
Edits in Original Sequence 
(5')AAXCCTACTGAGTTTAGGCTATCAGTTGTAGGCGXGGTGATCTTTTATGTTTTGGTCCTCAAACACAAGCCTAACTCCTTGATAAC
TGCAGGATATGTACGAAAGATAACTGCACGCAAGGACATTGATGTGATGGAGGACTTGGACAATGGAGCCCtCTGACATGGCGCATCAAT
ATAGTCTAGACCCATATTACATTGCTCATTATTTAAAGGaGTTCAATTCCTCATTACTTCAGGATTCTTAGAAAGTTTTATGTATTCCAA
GCTTTTGATAGTCATTTGGCGTTGTGTAGATATTCAAATGAGAGATTCGATGGCXCCATAGATAAGGATGCCTTGTCCAGAAAAGTGCTC
TTTTTGGGATTCTTTTTTCCAGCgTCAGAAGAAATCAAGAATTTATTCTTTCCCTATTAACATAAAATTACCATCTGTaTTCCTCTCTTC
ATGTCCATTTACTTGAGAATCCGGCCGTCACGGGCAAGTTGGTGAGGAATAAAGTTATTXCTGCCTTATCTCCTCCCTACTTAAGAAGCA
TAGGTATATATGCCTTTTTGCTTGGTGATATCAAATTCGcATAACTGTTTCGTTATAATATTCGATGTGAAGACTCGAGACCTCAtAGTG
CTTGGAATTTGAGAAGCCCGTTGTTGXTGGTCGGCTCCTAACAGCAGCTGAAATATGCCAAAAGTTAGTTTTcTGGGTTTCCAGTATGGC
CTCCCGAAAAGAAATTTTTTGCGGAAGCCATCTCGTCtGTTTTCCAAAGATGGGCATAATTCTAGTAAGTTACCCGCTTATCAGCAAAGC
TTAGAGGAGACGAAGCAGGTTTTCGACAAATATGACGCAAACAAAGATGGCAAGATTTCACCTGAGGAGTACAAGGCCATATTGAAAGCC
CTGGGAAAGGGAAATCCGCTTACAGTAGAAGTGAAAAAGATATTCGAGGTGGCAGATTTGGATGGTGATGGATTCATTGATTTCAAAGAG
TTCGTGGAAGTGCAGAAGAAAGAAGGCGGGTTAAAGACGGCGGACTTACAGAACGCTTTTCGGACATTCGACATGGATGGCGATGGAAAG
ATAACTGTGGAGGAAGTTTTCGAGTTGTTGCAGAAACTTGGAGAGAGGTGCAGCATGAAGGATTGTAGAAGAATG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan