ESTScan Details for Unigene SGN-U303067

Score 
747
Direction 
Forward
Predicted Peptide Sequence 
NSSVLGAIGHLVLVAALFNAPDVCITDTLXIDTPAIQINSARSPVFIGFGRPEERREQKQMGKGGMSAPENQDGGEENMAAWLVGLNTLR
IQPFKLPPLGPHDVRVRMKAVGICGSDVHFLKTLQLAHFVVKEPMVIGHECAGVIEEIGGEVKTLVPGDRVALEPGTVVGDVIIAEEADX
NMCPEMKFFATPPVHGSLANQVVHPANLCFKLPDNVSLEEGAMCEPLSVGVYACRRAGVGPGTRVLVMGAGPIGLVAMLAARAFGAPRVV
IVDVDDYRLSVAKQLGADETVKVSNNMQDVPEEVEQIRKAMGAEIDVSLDCAGFNKTMSTALGATRAGGRVGLVGLGHKEMTLPLAPAAA
REVDIIGIFRYTNTWPLCLEFISSGKIDVKPLITHRFGFSEQEVKEAFETSAHGGTAIKVMFXPLMERGGEVVPPAPAACNVIQKMQT
Predicted Coding Sequence 
AATTCGTCTGTACTCGGTGCCATTGGCCATCTTGTACTAGTAGCGGCACTGTTTAACGCACCGGACGTCTGCATCACAGATACCCTTCXG
ATTGATACACCAGCGATCCAGATAAACTCTGCTCGCTCCCCTGTATTCATTGGCTTTGGAAGACCAGAGGAGAGGAGAGAGCAGAAGCAA
ATGGGCAAGGGTGGTATGAGTGCTCCAGAGAACCAAGATGGTGGGGAAGAGAATATGGCAGCTTGGCTTGTGGGTCTTAACACCCTCAGG
ATTCAGCCTTTCAAGCTCCCTCCTCTTGGACCCCATGATGTTAGAGTCCGGATGAAAGCTGTTGGTATCTGTGGAAGCGATGTTCATTTT
CTCAAGACTTTGCAGCTAGCTCATTTTGTTGTTAAAGAGCCGATGGTTATTGGGCACGAGTGTGCTGGGGTCATTGAAGAAATTGGTGGT
GAAGTTAAGACTCTTGTGCCTGGTGATCGCGTGGCACTGGAGCCTGGAACAGTTGTTGGCGATGTGATCATTGCAGAGGAGGCCGATXAT
AATATGTGCCCAGAGATGAAGTTTTTTGCTACTCCGCCTGTTCATGGTTCTCTTGCGAATCAGGTCGTGCATCCCGCAAATTTGTGCTTC
AAATTACCTGATAACGTGAGCCTGGAGGAAGGAGCCATGTGCGAGCCCTTGAGCGTTGGCGTTTATGCTTGCCGCCGCGCCGGAGTTGGT
CCCGGGACGCGTGTGTTGGTGATGGGAGCTGGTCCCATAGGGCTTGTTGCAATGCTTGCCGCCCGTGCTTTTGGGGCCCCGAGGGTTGTG
ATAGTGGATGTCGATGACTACCGTTTGTCGGTTGCCAAACAGCTTGGTGCGGATGAAACTGTCAAAGTTTCTAACAACATGCAGGATGTG
CCGGAGGAAGTGGAACAGATTCGGAAGGCTATGGGGGCTGAGATTGATGTGAGTCTTGATTGTGCTGGGTTCAATAAAACCATGTCTACA
GCCCTTGGTGCCACCCGTGCAGGCGGCAGAGTCGGTCTCGTTGGTTTGGGTCACAAGGAGATGACTCTTCCTCTCGCCCCTGCTGCTGCG
AGGGAGGTCGACATTATAGGAATATTTCGGTACACGAACACGTGGCCCTTGTGTCTTGAGTTTATAAGCAGCGGCAAGATTGACGTGAAG
CCCTTGATAACCCACAGGTTTGGCTTCTCCGAGCAAGAGGTCAAAGAAGCCTTTGAAACCAGCGCTCATGGTGGCACTGCGATTAAGGTT
ATGTTTAAXCCTCTGATGGAGAGAGGAGGTGAAGTGGTACCGCCTGCTCCTGCTGCTTGTAATGTAATACAGAAAATGCAAACG
Edits in Original Sequence 
(5')AATTCGTCTGTACTCGGTGCCATTcGGCCATCTTGTACTAGTAGCGGCACTGTTTAACGCACCGGACGTCTGCATCACAGATACCC
TTCXGATTGATACACCAGCGATCCAGATAAACTCTGCTCGCTCCCCTGTATTCATTcGGCTTTGGAAGACCAGAGGAGAGGAGAGAGCAG
AAGCAAATGGGCAAGGGTGGTATGAGTGCTCCAGAGAACCAAGATGGTGGGGAAGAGAATATGGCAGCTTGGCTTGTGGGTCTTAACACC
CTCAGGATTCAGCCTTTCAAGCTCCCTCCTCTTGGACCCCATGATGTTAGAGTCCGGATGAAAGCTGTTGGTATCTGTGGAAGCGATGTT
CATTTTCTCAAGACTTTGCAGCTAGCTCATTTTGTTGTTAAAGAGCCGATGGTTATTGGGCACGAGTGTGCTGGGGTCATTGAAGAAATT
GGTGGTGAAGTTAAGACTCTTGTGCCTGGTGATCGCGTGGCACTGGAGCCTGGAAtCAGTTGTTGGCGATGTGATCATTGCAGAGGAGGC
CGATXATAATATGTGCCCAGAGATGAAGTTTTTTGCTACTCCGCCTGTTCATGGTTCTCTTGCGAATCAGGTCGTGCATCCCGCAAATTT
GTGCTTCAAATTACCTGATAACGTGAGCCTGGAGGAAGGAGCCATGTGCGAGCCCTTGAGCGTTGGCGTTTATGCTTGCCGCCGCGCCGG
AGTTGGTCCCGGGACGCGTGTGTTGGTGATGGGAGCTGGTCCCATAGGGCTTGTTGCAATGCTTGCCGCCCGTGCTTTTGGGGCCCCGAG
GGTTGTGATAGTGGATGTCGATGACTACCGTTTGTCGGTTGCCAAACAGCTTGGTGCGGATGAAACTGTCAAAGTTTCTAACAACATGCA
GGATGTGCCGGAGGAAGTGGAACAGATTCGGAAGGCTATGGGGGCTGAGATTGATGTGAGTCTTGATTGTGCTGGGTTCAATAAAACCAT
GTCTACAGCCCTTGGTGCCACCCGTGCAGGCGGCAGAGTCGGTCTCGTTGGTTTGGGTCACAAGGAGATGACTCTTCCTCTCGCCCCTGC
TGCTGCGAGGGAGGTCGACATTATAGGAATATTTCGGTACACGAACACGTGGCCCTTGTGTCTTGAGTTTATAAGCAGCGGCAAGATTGA
CGTGAAGCCCTTGATAACCCACAGGTTTGGCTTCTCCGAGCAAGAGGTCAAAGAAGCCTTTGAAACCAGCGCTCATGGTGGCACTGCGAT
TAAGGTTATGTTTAAXCCTCTGATGGAGAGAGGAGGTGAAGTGGTACCGCCTGCTCCTGCTGCTTGTAATGTAATACAGAAAATGCAAAC
G(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan