ESTScan Details for Unigene SGN-U303088

Score 
412
Direction 
Forward
Predicted Peptide Sequence 
ANERFDDFELSNVAKNIGDHISKYFPGAALLLLDNKKLEALPKGKDRNPVMQLYTKDASRSWKLVGSDRLTVKEPSANVILLDFISSKKW
KDITDFDDHLDDISKDWQTQTFSTKVRLQSHFVLCYCWQFLIIFLSGIDKRLQHQLLSERPNMMKINTLSWRRRNIFHGVFDYQWFFGSI
TFK
Predicted Coding Sequence 
GCGAACGAAAGATTTGATGATTTTGAGCTAAGCAATGTGGCGAAGAATATTGGTGATCACATTAGCAAATATTTTCCTGGAGCTGCTTTG
CTTTTGCTGGATAACAAAAAGCTTGAGGCTCTGCCGAAAGGGAAAGATAGGAATCCTGTGATGCAGCTTTACACAAAGGATGCATCTAGG
AGTTGGAAGCTAGTTGGATCAGATAGGCTGACTGTCAAGGAGCCTTCAGCCAATGTGATCCTTTTGGATTTTATATCATCTAAGAAATGG
AAGGATATCACAGATTTCGATGACCACCTTGATGATATTAGCAAGGACTGGCAAACTCAGACCTTTTCAACTAAAGTTCGATTGCAGAGT
CATTTTGTTCTCTGCTACTGCTGGCAATTCTTAATTATTTTTCTCAGTGGCATTGATAAGAGATTGCAACACCAATTGCTTTCTGAAAGA
CCTAATATGATGAAGATCAATACTTTAAGCTGGCGTAGAAGAAACATTTTTCATGGTGTATTTGATTATCAATGGTTCTTTGGTAGCATA
ACTTTCAAATAG
Edits in Original Sequence 
(5')GCGAACGAAAGATTTGATGATTTTGAGCTAAGCAATGTGGCGAAGAATATTGGTGATCACATTAGCAAATATTTTCCTGGAGCTGC
TTTGCTTTTGCTGGATAACAAAAAGCTTGAGGCTCTGCCGAAAGGGAAAGATAGGAATCCTGTGATGCAGCTTTACACAAAGGATGCATC
TAGGAGTTGGAAGCTAGTTGGATCAGATAGGCTGACTGTCAAGGAGCCTTCAGCCAATGTGATCCTTTTGGATTTTATATCATCTAAGAA
ATGGAAGGATATCACAGATTTCGATGACCACCTTGATGATATTAGCAAGGACTGGCtAAACTCAGACCTTTTCAACTAAAGTTCGATTGC
AGAGTCATTTTGTTCTCTGCTACTGCTGGCAATTCTTAATTATTTTTCTCAGTGGCATTGATAAGAGATTGCAACACCAATTGCTTTCTG
AAAGACCTAATATGATGAAGATCAATACTTTAAGCTGGCGTAGAAGAAACATTTTTCATGGTGTATTTGATTATCAATGGTTCTTTGGTA
GCATAACTTTCAAATAG(3')AAACTGGATATTTACCTTTGAAGAATAGCTTGTGTATCTGATACCTTAAAAATATTTATCTTAGAAGAA
TTTGAAGATTCTGTTTGCAGTGCAGCAGATCGCGGTGTCTTCATTGGGAAGATACCTCCTATTTTCTGTGGTGTTTTGTGTTGTTATGGA
GGTGAAATGGATAATACCCCTTTTCTTAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan