ESTScan Details for Unigene SGN-U303143

Score 
743
Direction 
Forward
Predicted Peptide Sequence 
MAEKDGQLNSNHDLIQTMELPMVDVSILTQDSNEKSIVIKQIQEACQTWGAFQVINHGVSESVIQAAMEVNRNFFDLPEMMKKEILELGS
RDMFSPVKLLTFQRSDLLQRELVRLYANPFEDFIDFWPTDPADYREKMGRYTKDVRKLGITLFGAIMESLNLGPTHLQENFDKGMHMVIA
NSYSPPTPESSIKLGAAPHSDHGIIIILRQSSPGLEVLDMADGKWKALPCSEGSPSVLVGXPSGAI
Predicted Coding Sequence 
ATGGCTGAAAAAGATGGTCAGCTCAACAGTAATCATGACCTGATCCAAACCATGGAACTGCCTATGGTTGACGTTTCCATCCTTACCCAA
GATTCTAACGAGAAGTCTATAGTCATCAAGCAGATTCAAGAAGCTTGCCAAACTTGGGGCGCTTTTCAGGTTATTAATCATGGGGTATCC
GAATCAGTCATACAAGCCGCCATGGAAGTGAACAGAAACTTCTTTGACTTGCCGGAGATGATGAAAAAGGAGATATTGGAGCTTGGTTCC
AGGGACATGTTCAGCCCAGTAAAACTGCTTACTTTTCAACGCAGTGACCTGCTCCAAAGGGAATTAGTGAGGCTTTATGCCAATCCTTTT
GAAGACTTCATTGATTTCTGGCCCACCGATCCTGCTGATTACAGGGAGAAAATGGGAAGGTACACTAAGGACGTGAGAAAATTGGGCATC
ACATTGTTTGGAGCCATCATGGAAAGCTTGAACTTGGGTCCAACACACCTTCAAGAAAATTTCGATAAAGGAATGCACATGGTTATAGCA
AACAGTTACTCACCACCAACTCCAGAATCAAGCATCAAGCTAGGTGCAGCTCCTCATTCCGATCATGGCATCATCATCATTCTCCGGCAA
AGCTCACCGGGTCTTGAGGTCCTGGACATGGCTGATGGCAAATGGAAAGCTCTTCCTTGCTCAGAAGGGTCCCCTTCAGTCCTTGTTGGA
GXACCATCTGGAGCTATT
Edits in Original Sequence 
CTTCGATACGAAATATCTGATACATTTTGATAATCTTC(5')ATGGCTGAAAAAGATGGTCAGCTCAACAGTAATCATGACCTGATCCAA
ACCATGGAACTGCCTATGGTTGACGTTTCCATCCTTACCCAAGATTCTAACGAGAAGTCTATAGTCATCAAGCAGATTCAAGAAGCTTGC
CAAACTTGGGGCGCTTTTCAGGTTATTAATCATGGGGTATCCGAATCAGTCATACAAGCCGCCATGGAAGTGAACAGAAACTTCTTTGAC
TTGCCGGAGATGATGAAAAAGGAGATATTGGAGCTTGGTTCCAGGGACATGTTCAGCCCAGTAAAACTGCTTACTTTTCAACGCAGTGAC
CTGCTCCAAAGGGAATTAGTGAGGCTTTATGCCAATCCTTTTGAAGACTTCATTGATTTCTGGCCCACCGATCCTGCTGATTACAGGGAG
AAAATGGGAAGGTACACTAAGGACGTGAGAAAATTGGGCATCACATTGTTTGGAGCCATCATGGAAAGCTTGAACTTGGGTCCAACACAC
CTTCAAGAAAATTTCGATAAAGGAATGCACATGGTTATAGCAAACAGTTACTCACCACCAACTCCAGAATCAAGCATCAAGCTAGGTGCA
GCTCCTCATTCCGATCATGGCATCATCATCATTCTCCGGCAAAGCTCACCGGGTCTTGAGGTCCTGGACATGGCTGATGGCAAATGGAAA
GCTCTTCCTTGCTCAGAAGGGTCCCCTTCAGTCCTTGTTGGAGXACCATCTGGAGCTATT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan