Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U303271

Score 
181
Direction 
Forward
Predicted Peptide Sequence 
DKIRPLWRHYFQNTQGLIFVVDSNDKERISEARDELHRMLNEEELRDAILLVFANKQDLPNAMRVSEITDKLGLHSLRRAAGISRVPAAT
SGQGLYEGLDWLSSNXLKQGITAEAVNLAPPELISLRLEGNESQIPAKKFRMQNGHEQVKAPHFASSKCNAEGXDTVCEMASSSVPIFLF
AFFAXDGNESLLSPCLNCFFGTKGSTIIPHG
Predicted Coding Sequence 
GATAAGATTCGACCTTTATGGAGGCACTACTTTCAGAACACTCAGGGCCTTATTTTCGTAGTTGATAGTAATGACAAAGAAAGAATTTCA
GAAGCAAGAGATGAGCTCCATCGAATGCTTAATGAGGAGGAACTACGTGATGCCATCCTTCTTGTCTTTGCCAATAAGCAAGATCTTCCA
AATGCCATGAGAGTCTCTGAAATCACAGATAAACTTGGCCTCCACTCACTCCGTCGCGCCGCTGGTATATCCAGAGTGCCTGCXGCAACT
TCGGGTCAGGGACTCTACGAGGGCCTAGATTGGTTGTCTAGCAATXATCTCAAGCAAGGCATAACTGCAGAAGCTGTCAACTTGGCGCCT
CCAGAACTTATTTCCTTACGTCTAGAGGGTAATGAATCACAAATTCCTGCAAAGAAATTTAGGATGCAGAACGGGCATGAGCAAGTGAAA
GCCCCTCATTTTGCATCGAGTAAGTGTAATGCAGAAGGTXCTGATACTGTGTGCGAAATGGCATCTTCTTCTGTTCCTATTTTTCTTTTT
GCCTTTTTTGCTGXTGATGGTAATGAATCACTTCTTAGCCCCTGCCTGAACTGTTTCTTTGGAACTAAAGGTAGTACAATTATTCCACAT
GGTTGA
Edits in Original Sequence 
(5')GATAAGATTCGACCTTTATGGAGGCACTACTTTCAGAACACTCAGGGCCTTATTTTCGTAGTTGATAGTAATGACAAAGAAAGAAT
TTCAGAAGCAAGAGATGAGCTCCATCGAATGCTTAATGAGGAGGAACTACGTGATGCCATCCTTCTTGTCTTTGCCAATAAGCAAGATCT
TCCAAATGCCATGAGAGTCTCTGAAATCACAGATAAACTTGGCCTCCACTCACTCCGTCaGCGCCGCTGGTATATCCAGAGTGCCTGCXG
CAACTTCGGGTCAGGGACTCTACGAGGGCCTAGATTGGTTGTCTAGCAATXATCTCAAGCAAGGCATAACTGCAGAAGCTGTCAACTTGG
CGCCTCCAGAACTTATTTCCTTACGTCTAGAcGGGTAATGAATCACAAATTCCTGCtAAAGAAATTTAGGATGCAGAACGGGCATGAGCA
AGTGAAAGCCCCgTCATTTTGCATCGAGTAAGTGTAATGCAGAAGGTXCTGATACTGTGTGCGAAATGGCATCTTCTTCTGTTCCTATTT
TTCTTTTTGCCTTTTTTGCTGXTGATGGTAATGAATCACTTCTTAGCCCCTGCCTGAACTGTTTCTTTGGAACTAAAGGTAGTACAATTA
TTCCACATGGTTGA(3')TTCCTGTAAACTTCAACCAATGATGATGAACTCAGCAAGAGAAATGGGATACTCAATTTAGTTCAAAAAAAA
AAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan